Player Messerknecht has no weapon equipped at the Main-Hand slot.

SimulationCraft 1100-02

for World of Warcraft 11.0.7.58911 Live (hotfix 2025-02-03/58911, git build d2465f0)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Combo 1 : 1,471,508 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,471,508.01,471,508.02,900.3 / 0.197%186,803.8 / 12.7%49,173.4
Resource Out In Waiting APM Active
Energy29.929.711.62%57.2100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 11,471,508
Auto Attack 0 (70,391)0.0% (4.8%)3.9122.60s5,352,1100

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,9943.2%353.40.98s39,69340,598Direct353.438,39877,55739,69419.4%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage353.43353.430.000.000.000.97770.000014,028,757.9118,301,205.9923.35%40,597.9940,597.99
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.15%226.7116529738,398.1922,84264,23838,411.6236,53640,1948,704,81411,356,43423.35%
crit19.42%68.644110277,557.4748,041128,66977,610.0770,08286,3035,323,9436,944,77223.34%
miss16.43%58.0732870.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3971.6%352.80.98s19,80020,182Direct352.819,12138,61119,79919.4%16.2%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage352.82352.820.000.000.000.98110.00006,985,719.409,113,006.7523.34%20,182.0720,182.07
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.33%226.9816029819,121.2311,33031,98819,129.3118,25920,0134,340,1615,662,59423.35%
crit19.42%68.534010638,611.1922,69464,07238,628.6735,12043,1532,645,5583,450,41223.33%
miss16.24%57.3134880.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2652.1%75.13.68s120,519119,980Direct75.172,990188,547120,47841.1%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.1375.130.000.000.001.00450.00009,054,043.6911,843,964.8023.56%119,979.91119,979.91
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.87%44.23256672,989.7257,139141,61573,002.8969,08977,9623,228,3114,224,97523.58%
crit41.13%30.901651188,547.17125,912399,661188,641.42171,561214,3245,825,7327,618,99023.55%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.13

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,752 (128,091)6.1% (8.7%)13.322.25s2,881,8812,392,629Direct39.7 (78.0)518,5381,050,693674,58829.3% (29.3%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2639.720.000.000.001.20450.000026,781,142.6834,866,912.4123.19%2,392,628.512,392,628.51
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.69%28.081643518,537.82119,7431,969,500519,000.45363,468697,81714,558,67118,954,58223.19%
crit29.31%11.642221,050,693.48240,5733,891,2851,048,397.74351,9412,224,79612,222,47215,912,33023.19%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.26
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,3392.6%0.00.00s00Direct38.3230,279464,533298,88829.3%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.270.000.000.000.00000.000011,438,705.1511,438,705.150.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.68%27.051444230,279.0457,087854,439230,627.05155,737308,9336,226,7666,226,7660.00%
crit29.32%11.22223464,532.74114,3451,610,046464,415.18195,297760,2865,211,9395,211,9390.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,955)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,9551.4%22.112.96s269,6580Direct22.1269,7650269,7650.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.1122.110.000.000.000.00000.00005,962,982.955,962,982.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.111038269,764.72260,578314,635269,731.28261,852280,7235,962,9835,962,9830.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 257,253 (367,673)17.5% (25.0%)68.44.35s1,602,5871,595,416Direct68.4 (135.6)858,4311,758,9301,121,83429.2% (29.0%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.4468.440.000.000.001.00450.000076,750,845.5499,837,254.9423.12%1,595,415.811,595,415.81
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.76%48.433367858,431.07210,8622,571,678858,099.16708,1391,035,12141,553,29454,057,21723.13%
crit29.24%20.027361,758,929.66422,3574,807,4261,759,727.291,128,0602,555,59535,197,55245,780,03823.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.44

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,4207.5%67.24.43s490,2340Direct67.2377,661768,869490,47828.8%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.1967.190.000.000.000.00000.000032,937,182.3032,937,182.300.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.16%47.812966377,661.13100,5271,115,686377,705.80320,392451,19018,052,15318,052,1530.00%
crit28.84%19.38737768,869.04201,3562,109,953769,676.34514,8831,068,46114,885,03014,885,0300.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,029 (21,055)0.1% (1.4%)3.791.18s1,704,0361,696,820Direct3.7 (27.5)69,672139,64182,99619.0% (19.9%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.693.690.000.000.001.00450.0000306,353.94306,353.940.00%1,696,819.861,696,819.86
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.95%2.990469,671.6560,925139,33169,574.140108,289208,197208,1970.00%
crit19.05%0.7003139,640.52122,033269,38475,109.770224,94498,15798,1570.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.69
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,0261.4%0.00.00s00Direct23.8209,715419,266251,79720.1%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.770.000.000.000.00000.00005,982,060.475,982,060.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.94%19.001027209,715.1679,617452,357209,620.64173,027241,6673,985,7563,985,7560.00%
crit20.06%4.77013419,265.96159,955888,348415,070.840718,7121,996,3041,996,3040.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2370.8%0.00.00s00Direct282.710,79521,77312,92219.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00282.720.000.000.000.00000.00003,653,161.813,653,161.810.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.62%227.9415031010,794.987,51417,53410,798.0610,19811,5162,460,3582,460,3580.00%
crit19.38%54.78298721,773.4815,05135,12221,789.0619,53424,8111,192,8041,192,8040.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,844 (117,034)6.7% (8.0%)9.531.41s3,674,5583,658,158Periodic166.7 (333.4)135,733282,039176,96828.2% (28.2%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.510.00166.71166.717.071.00451.740129,500,147.6429,500,147.640.00%116,566.073,658,157.86
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.80%119.7083156135,732.7167439,999135,800.50121,415152,00716,243,72716,243,7270.00%
crit28.20%47.012576282,038.57403865,525282,345.13220,026352,54813,256,42013,256,4200.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.50
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1891.2%166.71.76s32,5600Periodic166.724,97751,81832,57228.3%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage166.710.000.00166.710.000.00000.00005,427,943.645,427,943.640.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.72%119.568515824,976.999,67180,67924,988.1322,22327,8392,985,9382,985,9380.00%
crit28.28%47.14217351,817.5019,371156,54951,895.2440,86669,6982,442,0052,442,0050.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,858)0.0% (18.5%)16.018.90s5,078,6845,056,175

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.980.000.000.000.001.00450.00000.000.000.00%5,056,174.835,056,174.83

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.98
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,6374.7%0.00.00s00Direct16.0683,7552,124,0011,301,12942.9%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.980.000.000.000.00000.000020,788,775.7927,097,613.9123.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.14%9.13314683,754.65150,6161,740,360684,085.87454,336934,7166,241,3778,157,58323.50%
crit42.86%6.853132,124,000.64301,6844,313,3142,163,866.601,380,8693,251,98214,547,39918,940,03123.19%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,22113.7%0.00.00s00Direct31.9994,4443,027,6451,894,81744.3%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.890.000.000.000.00000.000060,388,111.1060,388,111.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.72%17.771027994,443.76221,6202,516,768995,835.85745,8831,257,62617,665,56317,665,5630.00%
crit44.28%14.127253,027,645.27445,2516,237,5653,052,083.872,107,9894,414,76042,722,54842,722,5480.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,911)0.0% (7.1%)3.690.70s8,641,9720

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.630.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.63
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,9117.1%384.11.18s81,5730Periodic384.181,587081,5870.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage384.110.000.00384.110.000.00000.000031,332,966.4331,332,966.430.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%384.1128247481,587.45921,090,32481,618.7270,62495,16931,332,96631,332,9660.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5377.77
  • base_dd_max:5377.77
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 118,1798.0%52.25.79s674,518671,500Direct52.2280,242915,996674,63962.0%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2352.230.000.000.001.00450.000035,226,888.5445,929,738.2223.30%671,499.97671,499.97
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.96%19.821133280,241.88130,261417,543280,183.25254,156318,1865,554,5897,237,42423.25%
crit62.04%32.402147915,995.70287,0431,411,743916,639.53840,9741,001,50229,672,30038,692,31523.31%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.21

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,6020.2%2.372.63s475,8370Direct2.3400,698807,503475,74118.6%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.00001,072,555.681,072,555.680.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.38%1.8308400,698.12377,346496,943341,011.450456,134734,022734,0220.00%
crit18.62%0.4203807,502.55755,824929,199271,178.830921,020338,534338,5340.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8490.1%2.373.45s109,5810Direct2.391,804183,745109,72019.3%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.312.310.000.000.000.00000.0000253,590.01253,590.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.68%1.870691,804.1083,958124,92078,269.190110,995171,439171,4390.00%
crit19.32%0.4504183,745.02168,168248,11666,449.230235,07882,15182,1510.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71109.06
  • base_dd_max:71109.06
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,0783.2%19.015.01s738,5140Periodic106.8131,6300131,6300.0%0.0%71.5%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.040.00106.82106.8212.130.00002.000014,064,919.0814,064,919.080.00%65,831.900.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%106.8263152131,630.0960,995223,421130,742.1373,457177,88114,064,91914,064,9190.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 68,4514.7%34.48.49s594,8130Direct34.4498,156997,830594,91419.3%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage34.3834.380.000.000.000.00000.000020,449,492.9820,449,492.980.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.68%27.74945498,156.39453,001885,371498,041.81466,822539,98713,819,32113,819,3210.00%
crit19.32%6.64018997,830.48907,3601,731,510996,902.0101,264,8616,630,1726,630,1720.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4570.3%2.373.60s574,6950Direct2.3481,506965,384574,09619.3%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.00001,331,496.011,331,496.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.74%1.8707481,505.77452,539595,968404,959.930578,822900,673900,6730.00%
crit19.26%0.4504965,384.25906,4361,140,058349,263.2701,140,058430,823430,8230.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,4235.8%58.05.14s439,7520Direct58.0367,685741,593439,70019.3%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.9957.990.000.000.000.00000.000025,500,896.3833,308,307.8023.44%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.72%46.812667367,685.36220,828566,211367,791.22336,625398,66817,209,92522,483,98623.46%
crit19.28%11.18224741,592.76442,3191,118,007743,022.00559,516916,5938,290,97210,824,32123.40%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 1
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.590.49s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.550.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.55
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.72s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.710.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.411.54s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.430.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.367.99s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.369.13s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.260.0066.470.000.300.00000.83440.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5308.47s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.460.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.45
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.43.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.367.40s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.08s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.27
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.373.45s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.312.310.000.000.000.00000.00000.001,588,827.450.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.31090.00000.000001,588,82791.65%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8490.1%2.373.45s109,5810Direct2.391,804183,745109,72019.3%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.312.310.000.000.000.00000.0000253,590.01253,590.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.68%1.870691,804.1083,958124,92078,269.190110,995171,439171,4390.00%
crit19.32%0.4504183,745.02168,168248,11666,449.230235,07882,15182,1510.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71109.06
  • base_dd_max:71109.06
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.221.27s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.230.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.23
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.60s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 1
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.471.45s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.360.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1589.8162.2s0.5s280.2s99.94%100.00%580.2 (580.2)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:10.7s / 340.1s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 359.9s
  • uptime_min/max:99.22% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.23%
  • acrobatic_strikes_2:0.23%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.34%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.282.4118.6s3.5s131.0s97.41%0.00%74.3 (77.1)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 335.3s
  • trigger_min/max:1.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 357.9s
  • uptime_min/max:87.32% / 99.44%

Stack Uptimes

  • alacrity_1:2.95%
  • alacrity_2:2.16%
  • alacrity_3:1.73%
  • alacrity_4:1.58%
  • alacrity_5:88.98%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.57%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.09%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.6s
  • trigger_min/max:9.2s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 7.0s
  • uptime_min/max:32.19% / 40.71%

Stack Uptimes

  • bolstering_shadows_1:37.09%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.50.090.7s90.7s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:83.0s / 181.6s
  • trigger_min/max:83.0s / 181.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.10%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0132.4s111.4s4.3s1.83%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 276.5s
  • trigger_min/max:90.0s / 188.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.5s
  • uptime_min/max:0.00% / 6.87%

Stack Uptimes

  • cryptic_instructions_1:1.83%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.923.1s23.1s8.2s36.49%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 69.8s
  • trigger_min/max:8.0s / 69.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.78% / 39.39%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.61%
  • danse_macabre_4:16.50%
  • danse_macabre_5:8.80%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.141.0s3.7s35.6s90.12%95.69%74.1 (74.1)6.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 168.1s
  • trigger_min/max:1.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 152.4s
  • uptime_min/max:81.51% / 95.99%

Stack Uptimes

  • deeper_daggers_1:90.12%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.42%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.6s
  • trigger_min/max:9.2s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 6.2s
  • uptime_min/max:15.48% / 21.02%

Stack Uptimes

  • disorienting_strikes_1:12.21%
  • disorienting_strikes_2:6.20%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0132.9s114.7s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 294.0s
  • trigger_min/max:90.0s / 191.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 9.6s
  • uptime_min/max:0.00% / 6.56%

Stack Uptimes

  • errant_manaforge_emission_1:1.68%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.143.922.0s5.2s17.3s81.50%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 65.4s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.2s
  • uptime_min/max:66.09% / 92.79%

Stack Uptimes

  • escalating_blade_1:24.97%
  • escalating_blade_2:22.10%
  • escalating_blade_3:22.50%
  • escalating_blade_4:11.93%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.16%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:84.5s / 181.0s
  • trigger_min/max:84.5s / 181.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:13.74% / 20.82%

Stack Uptimes

  • ethereal_powerlink_1:18.16%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.284.2s71.2s15.4s10.80%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4576.07

Trigger Details

  • interval_min/max:15.1s / 310.2s
  • trigger_min/max:1.0s / 310.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 45.2s
  • uptime_min/max:0.00% / 35.82%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.80%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.8s14.63%0.00%14.2 (96.1)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 97.7s
  • trigger_min/max:1.0s / 88.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.87% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.30%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.77%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.56%
  • flagellation_buff_11:0.45%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.45%
  • flagellation_buff_20:0.40%
  • flagellation_buff_21:0.30%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.17%
  • flagellation_buff_25:0.84%
  • flagellation_buff_26:0.39%
  • flagellation_buff_27:0.20%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.08%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.20%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 97.7s
  • trigger_min/max:78.3s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 12.0s
  • uptime_min/max:12.36% / 16.24%

Stack Uptimes

  • flagellation_persist_30:14.20%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.7112.8s75.6s35.9s25.29%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 150.0s
  • uptime_min/max:0.00% / 74.60%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.29%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6110.8s76.4s35.2s24.71%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 302.5s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 78.50%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.73%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6108.9s76.0s35.4s25.36%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 341.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 70.75%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.36%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6113.2s76.2s35.3s24.64%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 338.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 210.0s
  • uptime_min/max:0.00% / 67.63%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.64%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.20.039.8s3.4s59.3s95.33%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.57%
  • flawless_form_2:8.70%
  • flawless_form_3:11.77%
  • flawless_form_4:9.68%
  • flawless_form_5:2.79%
  • flawless_form_6:4.50%
  • flawless_form_7:5.95%
  • flawless_form_8:11.23%
  • flawless_form_9:18.44%
  • flawless_form_10:8.93%
  • flawless_form_11:1.42%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.17%
  • flawless_form_16:0.08%
  • flawless_form_17:0.02%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.286.8s72.3s16.8s10.74%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.5s / 324.4s
  • trigger_min/max:0.1s / 324.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 62.4s
  • uptime_min/max:0.00% / 37.62%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.74%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.282.2s69.1s16.9s10.95%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.7s / 326.9s
  • trigger_min/max:0.3s / 314.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.1s
  • uptime_min/max:0.00% / 42.68%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.95%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.9s74.5s16.8s10.85%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:3.4s / 322.5s
  • trigger_min/max:0.3s / 303.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 51.7s
  • uptime_min/max:0.00% / 42.13%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.85%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)2.00.285.4s73.6s16.8s11.08%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:4.4s / 330.0s
  • trigger_min/max:0.1s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 50.1s
  • uptime_min/max:0.00% / 37.62%

Stack Uptimes

  • nascent_empowerment_Vers_1:11.08%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.522.1s21.3s3.7s17.20%100.00%0.5 (0.5)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 83.6s
  • trigger_min/max:1.0s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 28.1s
  • uptime_min/max:9.75% / 30.81%

Stack Uptimes

  • poised_shadows_1:17.20%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.8s1.1s2.65%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.3s
  • trigger_min/max:1.0s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.4s
  • uptime_min/max:0.37% / 4.87%

Stack Uptimes

  • premeditation_1:2.65%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0130.5s112.3s3.9s1.60%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.6s
  • trigger_min/max:90.0s / 186.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 10.0s
  • uptime_min/max:0.00% / 6.76%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.60%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.281.1s68.8s15.4s10.84%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23996.43

Trigger Details

  • interval_min/max:15.0s / 317.8s
  • trigger_min/max:0.3s / 310.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 35.6s
  • uptime_min/max:0.00% / 39.29%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.85%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.8s90.8s15.8s19.18%17.12%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.2s
  • trigger_min/max:90.0s / 97.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 16.0s
  • uptime_min/max:16.90% / 21.88%

Stack Uptimes

  • shadow_blades_1:19.18%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.49%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 69.8s
  • trigger_min/max:8.0s / 69.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.78% / 39.39%

Stack Uptimes

  • shadow_dance_1:36.49%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.0138.14.4s1.4s3.5s79.15%95.43%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 41.3s
  • trigger_min/max:0.5s / 6.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.6s
  • uptime_min/max:70.56% / 86.88%

Stack Uptimes

  • shadow_techniques_1:20.47%
  • shadow_techniques_2:20.96%
  • shadow_techniques_3:9.39%
  • shadow_techniques_4:10.51%
  • shadow_techniques_5:6.05%
  • shadow_techniques_6:5.85%
  • shadow_techniques_7:2.58%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.51%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s296.8s99.32%87.43%98.4 (98.4)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0106.6s94.4s10.0s1.63%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.1s / 302.1s
  • trigger_min/max:2.0s / 302.1s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 19.2s
  • uptime_min/max:0.00% / 14.81%

Stack Uptimes

  • storm_sewers_citrine_1:1.63%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0121.8s109.1s9.9s1.49%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.4s / 290.1s
  • trigger_min/max:3.0s / 290.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s
  • uptime_min/max:0.00% / 11.99%

Stack Uptimes

  • storm_sewers_citrine_1:1.49%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0108.3s100.3s9.9s1.36%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:12.1s / 301.3s
  • trigger_min/max:6.0s / 301.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.2s
  • uptime_min/max:0.00% / 16.27%

Stack Uptimes

  • storm_sewers_citrine_1:1.36%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0109.5s99.4s9.9s1.43%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.3s / 300.2s
  • trigger_min/max:2.9s / 300.2s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.0s
  • uptime_min/max:0.00% / 18.35%

Stack Uptimes

  • storm_sewers_citrine_1:1.43%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.284.0s72.1s15.4s11.03%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1427.95
  • stat:haste_rating
  • amount:1427.95
  • stat:mastery_rating
  • amount:1427.95
  • stat:versatility_rating
  • amount:1427.95

Trigger Details

  • interval_min/max:15.1s / 304.9s
  • trigger_min/max:1.0s / 304.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 40.4s
  • uptime_min/max:0.00% / 35.10%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:11.03%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s10.96%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 68.8s
  • trigger_min/max:4.0s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 6.6s
  • uptime_min/max:9.15% / 13.26%

Stack Uptimes

  • supercharge_1_1:10.96%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 68.8s
  • trigger_min/max:1.0s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.4s
  • uptime_min/max:0.41% / 4.09%

Stack Uptimes

  • supercharge_2_1:2.00%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s1.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 1.0s
  • uptime_min/max:0.00% / 0.35%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.56.743.1s21.3s24.3s61.18%100.00%6.7 (6.7)6.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.5s
  • trigger_min/max:1.0s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 67.0s
  • uptime_min/max:57.91% / 65.15%

Stack Uptimes

  • symbols_of_death_1:61.18%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0308.1s308.1s27.8s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.6s
  • trigger_min/max:300.0s / 329.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:9.95% / 18.06%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.81%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.84%22.26%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:4.0s / 68.8s
  • trigger_min/max:1.0s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.5s
  • uptime_min/max:11.27% / 16.74%

Stack Uptimes

  • the_rotten_1:10.77%
  • the_rotten_2:3.07%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.4s
  • trigger_min/max:120.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.39%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.042.6s14.1s15.0s0.48%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4550.35

Trigger Details

  • interval_min/max:21.0s / 64.3s
  • trigger_min/max:3.0s / 64.3s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 27.9s
  • uptime_min/max:0.00% / 10.99%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.60%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.284.9s72.3s15.3s10.53%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5516.42

Trigger Details

  • interval_min/max:15.0s / 316.2s
  • trigger_min/max:0.3s / 316.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.5s
  • uptime_min/max:0.00% / 33.50%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.53%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.427.076.06.0s0.7s77.6s
Skyfury (Off Hand)49.328.082.06.0s0.7s70.7s
Supercharger secret_technique12.47.017.023.6s9.2s94.8s
Cold Blood secret_technique3.53.04.090.7s83.0s181.6s
Supercharger rupture0.20.02.0204.0s172.5s274.5s
Supercharger coup_de_grace2.80.08.075.1s10.2s324.0s
Supercharger eviscerate12.97.021.023.1s1.0s151.4s
CP Spent During Flagellation201.5143.0249.011.1s1.0s89.2s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.39%5.90%13.15%0.7s0.0s2.0s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 1
Energy RegenEnergy1,433.333,025.3834.08%2.11397.3311.61%
Improved AmbushCombo Points52.2133.564.60%0.6418.6535.71%
PremeditationCombo Points17.1956.947.80%3.3163.3752.67%
Relentless StrikesEnergy107.204,264.9748.04%39.79124.382.83%
Shadow BladesCombo Points21.83113.4615.53%5.2017.5013.36%
Shadow TechniquesEnergy359.101,231.2113.87%3.43205.1814.28%
Shadow TechniquesCombo Points85.36240.3932.91%2.820.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.25106.7714.62%7.000.000.00%
BackstabCombo Points75.1374.8110.24%1.000.320.42%
ShadowstrikeCombo Points52.21104.4114.30%2.000.010.01%
Symbols of DeathEnergy14.23356.604.02%25.06212.6037.35%
Usage Type Count Total Tot% Avg RPE APR
Combo 1
BackstabEnergy75.133,005.2933.65%40.0040.003,012.70
Coup de GraceEnergy13.26464.205.20%35.0035.0082,334.75
Coup de GraceCombo Points13.2690.5012.46%6.826.82422,331.19
EviscerateEnergy68.442,395.5426.82%35.0035.0045,788.40
EviscerateCombo Points68.44466.5264.21%6.826.82235,122.14
RuptureEnergy9.50237.612.66%25.0025.00146,996.94
RuptureCombo Points9.5064.958.94%6.836.83537,729.95
Secret TechniqueEnergy15.98479.525.37%30.0030.00169,287.65
Secret TechniqueCombo Points15.98104.5314.39%6.546.54776,594.52
ShadowstrikeEnergy52.212,349.5126.31%45.0044.9914,993.28
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.7229.90939.146.60.2100.0
Combo Points0.02.442.4399.83.80.07.0

Statistics & Data Analysis

Fight Length
Combo 1 Fight Length
Count 1114
Mean 298.78
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Combo 1 Damage Per Second
Count 1114
Mean 1471507.99
Minimum 1316841.03
Maximum 1600611.77
Spread ( max - min ) 283770.75
Range [ ( max - min ) / 2 * 100% ] 9.64%
Standard Deviation 49389.4573
5th Percentile 1393527.74
95th Percentile 1554321.06
( 95th Percentile - 5th Percentile ) 160793.32
Mean Distribution
Standard Deviation 1479.7613
95.00% Confidence Interval ( 1468607.71 - 1474408.27 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4328
0.1 Scale Factor Error with Delta=300 20823426
0.05 Scale Factor Error with Delta=300 83293703
0.01 Scale Factor Error with Delta=300 2082342568
Priority Target DPS
Combo 1 Priority Target Damage Per Second
Count 1114
Mean 1471507.99
Minimum 1316841.03
Maximum 1600611.77
Spread ( max - min ) 283770.75
Range [ ( max - min ) / 2 * 100% ] 9.64%
Standard Deviation 49389.4573
5th Percentile 1393527.74
95th Percentile 1554321.06
( 95th Percentile - 5th Percentile ) 160793.32
Mean Distribution
Standard Deviation 1479.7613
95.00% Confidence Interval ( 1468607.71 - 1474408.27 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4328
0.1 Scale Factor Error with Delta=300 20823426
0.05 Scale Factor Error with Delta=300 83293703
0.01 Scale Factor Error with Delta=300 2082342568
DPS(e)
Combo 1 Damage Per Second (Effective)
Count 1114
Mean 1471507.99
Minimum 1316841.03
Maximum 1600611.77
Spread ( max - min ) 283770.75
Range [ ( max - min ) / 2 * 100% ] 9.64%
Damage
Combo 1 Damage
Count 1114
Mean 439218739.12
Minimum 349213289.92
Maximum 541864385.71
Spread ( max - min ) 192651095.79
Range [ ( max - min ) / 2 * 100% ] 21.93%
DTPS
Combo 1 Damage Taken Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 1 Healing Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 1 Healing Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 1 Heal
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 1 Healing Taken Per Second
Count 1114
Mean 3119.87
Minimum 0.00
Maximum 11597.50
Spread ( max - min ) 11597.50
Range [ ( max - min ) / 2 * 100% ] 185.86%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.21 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.13 backstab
actions.cds
# count action,conditions
F 3.55 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.45 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.23 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.63 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.69 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.98 secret_technique,if=variable.secret
L 9.50 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.26 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.44 eviscerate
actions.item
# count action,conditions
O 3.72 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.69 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.27 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDNHNDMQFKDNNDNDNENEEHQNDKDMDNDLEENEENHQDKNDDMDNEENEHLEKEENEENENEENEENEEMEEOJHQPKDNDINDNNENNQDFKHDMNDNNELENEEEENRDNEHQKDMDNDNDELEENEEKEEEMEEENEELEEENOEEJHQPKDIMDNNDNNHQDNFKDNDMDLNENHQDNDKDNDNENEENEENEEHQKDMDNDNDLEENEEKRDNEMEEENEEELEOEJHQPKDINDNNDMENHQNDFKDNNDNNENEEME

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Gpotion
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Jflagellation
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.007Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(4), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.011Rvanish
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.011Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(7), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.017Lrupture
[finish]
Fluffy_Pillow 73.1/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit, tempered_potion
0:05.023Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit, tempered_potion
0:05.023Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit, tempered_potion
0:05.023Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit, tempered_potion
0:05.023Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:06.027Ishadow_blades
[cds]
Combo 1 69.1/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:06.027Ksecret_technique
[finish]
Fluffy_Pillow 69.1/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:07.030Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:08.035Neviscerate
[finish]
Fluffy_Pillow 77.2/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(7), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:09.038Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:10.043Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:11.047Neviscerate
[finish]
Fluffy_Pillow 77.5/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:12.052Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:13.056Neviscerate
[finish]
Fluffy_Pillow 85.6/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:14.060Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:14.060Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:15.064Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:16.067Mcoup_de_grace
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(4), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:17.271Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:17.271Fcold_blood
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:17.271Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:18.276Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:19.281Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:20.285Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:21.290Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:22.294Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:23.298Dshadowstrike
[build]
Fluffy_Pillow 92.3/100 92% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:24.302Neviscerate
[finish]
Fluffy_Pillow 69.9/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(3), flagellation_persist(30), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:25.307Ebackstab
[build]
Fluffy_Pillow 92.6/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(5), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:26.312Neviscerate
[finish]
Fluffy_Pillow 83.2/100 83% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:27.316Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:28.320Ebackstab
[build]
Fluffy_Pillow 74.6/100 75% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:29.326Hsymbols_of_death
[cds]
Combo 1 57.3/100 57% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:29.326Qshadow_dance
[stealth_cds]
Combo 1 97.3/100 97% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:29.326Neviscerate
[finish]
Fluffy_Pillow 97.3/100 97% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:30.331Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit, tempered_potion
0:31.336Ksecret_technique
[finish]
Fluffy_Pillow 85.5/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
0:32.339Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
0:33.343Mcoup_de_grace
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_crit
0:34.547Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
0:35.552Neviscerate
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:36.557Dshadowstrike
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:37.561Lrupture
[finish]
Fluffy_Pillow 68.1/100 68% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:38.566Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:39.569Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:40.572Neviscerate
[finish]
Fluffy_Pillow 54.2/100 54% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:41.577Ebackstab
[build]
Fluffy_Pillow 68.0/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:42.686Ebackstab
[build]
Fluffy_Pillow 47.9/100 48% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:44.237Neviscerate
[finish]
Fluffy_Pillow 40.6/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:45.242Hsymbols_of_death
[cds]
Combo 1 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(8), shadow_techniques(5), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:45.242Qshadow_dance
[stealth_cds]
Combo 1 91.4/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(8), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:45.242Dshadowstrike
[build]
Fluffy_Pillow 91.4/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
0:46.246Ksecret_technique
[finish]
Fluffy_Pillow 65.2/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:47.341Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:48.347Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:49.352Dshadowstrike
[build]
Fluffy_Pillow 73.8/100 74% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:50.357Mcoup_de_grace
[finish]
Fluffy_Pillow 39.6/100 40% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:51.562Dshadowstrike
[build]
Fluffy_Pillow 85.5/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:52.566Neviscerate
[finish]
Fluffy_Pillow 59.3/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:53.572Ebackstab
[build]
Fluffy_Pillow 70.1/100 70% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:54.576Ebackstab
[build]
Fluffy_Pillow 48.9/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers, storm_sewers_citrine
0:55.809Neviscerate
[finish]
Fluffy_Pillow 38.2/100 38% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:56.813Ebackstab
[build]
Fluffy_Pillow 52.0/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(6), deeper_daggers, flask_of_alchemical_chaos_vers
0:57.817Hsymbols_of_death
[cds]
Combo 1 38.8/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
0:57.817Lrupture
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:58.823Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
0:59.828Ksecret_technique
[finish]
Fluffy_Pillow 78.8/100 79% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_vers
1:00.833Ebackstab
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_vers
1:01.837Ebackstab
[build]
Fluffy_Pillow 78.4/100 78% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:02.841Neviscerate
[finish]
Fluffy_Pillow 57.2/100 57% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
1:03.847Ebackstab
[build]
Fluffy_Pillow 71.0/100 71% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:04.851Ebackstab
[build]
Fluffy_Pillow 49.8/100 50% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:06.275Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
1:07.279Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
1:08.800Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:09.806Ebackstab
[build]
Fluffy_Pillow 50.0/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
1:11.486Ebackstab
[build]
Fluffy_Pillow 44.1/100 44% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
1:14.460Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
1:15.465Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
1:17.531Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:20.409Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:21.412Ebackstab
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:23.871Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:26.372Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:27.575Ebackstab
[build]
Fluffy_Pillow 69.0/100 69% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:28.707Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:29.825Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 17.2/100 17% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_crit
1:30.755Jflagellation
[cds]
Fluffy_Pillow 31.1/100 31% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:32.009Hsymbols_of_death
[cds]
Combo 1 48.6/100 49% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:32.009Qshadow_dance
[stealth_cds]
Combo 1 88.6/100 89% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:32.009Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 88.6/100 89% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
1:32.009Ksecret_technique
[finish]
Fluffy_Pillow 88.6/100 89% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:33.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
1:34.017Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:35.023Dshadowstrike
[build]
Fluffy_Pillow 99.6/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.027Ishadow_blades
[cds]
Combo 1 81.4/100 81% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:36.027Neviscerate
[finish]
Fluffy_Pillow 81.4/100 81% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:37.029Dshadowstrike
[build]
Fluffy_Pillow 92.1/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(6), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:38.033Neviscerate
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(10), flagellation_buff(26), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:39.038Neviscerate
[finish]
Fluffy_Pillow 92.7/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:40.043Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:41.047Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(9), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:42.052Neviscerate
[finish]
Fluffy_Pillow 97.6/100 98% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.056Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:43.056Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_mastery
1:44.062Fcold_blood
[cds]
Combo 1 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:44.062Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:45.066Hsymbols_of_death
[cds]
Combo 1 89.6/100 90% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:45.066Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:46.068Mcoup_de_grace
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:47.272Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, flawless_form(7), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:48.275Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:49.278Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:50.282Neviscerate
[finish]
Fluffy_Pillow 84.6/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:51.288Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:52.291Lrupture
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:53.297Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:54.303Neviscerate
[finish]
Fluffy_Pillow 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:55.308Ebackstab
[build]
Fluffy_Pillow 81.6/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:56.314Ebackstab
[build]
Fluffy_Pillow 52.4/100 52% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
1:58.229Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
2:01.236Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Crit, flask_of_alchemical_chaos_mastery
2:04.101Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:05.107Rvanish
[stealth_cds]
Combo 1 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:05.107Dshadowstrike
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:07.451Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:08.455Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(4), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:09.828Hsymbols_of_death
[cds]
Combo 1 20.9/100 21% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:10.024Qshadow_dance
[stealth_cds]
Combo 1 63.1/100 63% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:10.024Ksecret_technique
[finish]
Fluffy_Pillow 63.1/100 63% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
2:11.028Dshadowstrike
[build]
Fluffy_Pillow 91.9/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
2:12.034Mcoup_de_grace
[finish]
Fluffy_Pillow 57.8/100 58% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:13.239Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:14.244Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:15.248Dshadowstrike
[build]
Fluffy_Pillow 92.7/100 93% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:16.254Neviscerate
[finish]
Fluffy_Pillow 58.5/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
2:17.257Dshadowstrike
[build]
Fluffy_Pillow 77.4/100 77% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:18.262Ebackstab
[build]
Fluffy_Pillow 51.2/100 51% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:19.266Lrupture
[finish]
Fluffy_Pillow 30.1/100 30% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:20.272Ebackstab
[build]
Fluffy_Pillow 50.9/100 51% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:22.321Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:24.661Neviscerate
[finish]
Fluffy_Pillow 38.3/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), flask_of_alchemical_chaos_crit
2:25.664Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
2:28.289Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:30.695Ksecret_technique
[finish]
Fluffy_Pillow 31.7/100 32% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:31.700Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
2:34.697Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:37.363Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:39.544Mcoup_de_grace
[finish]
Fluffy_Pillow 35.5/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:40.748Ebackstab
[build]
Fluffy_Pillow 74.8/100 75% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:41.753Ebackstab
[build]
Fluffy_Pillow 50.8/100 51% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:43.807Ebackstab
[build]
Fluffy_Pillow 43.2/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:46.249Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:47.254Ebackstab
[build]
Fluffy_Pillow 52.2/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:49.401Ebackstab
[build]
Fluffy_Pillow 45.7/100 46% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:50.926Lrupture
[finish]
Fluffy_Pillow 27.4/100 27% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:51.929Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:54.319Ebackstab
[build]
Fluffy_Pillow 44.7/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
2:57.068Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:59.663Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.667Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 52.4/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:00.667Ebackstab
[build]
Fluffy_Pillow 52.4/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:02.713Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:03.717Jflagellation
[cds]
Fluffy_Pillow 13.4/100 13% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:04.721Hsymbols_of_death
[cds]
Combo 1 29.6/100 30% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:04.721Qshadow_dance
[stealth_cds]
Combo 1 69.6/100 70% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:04.721Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 69.6/100 70% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:04.721Ksecret_technique
[finish]
Fluffy_Pillow 69.6/100 70% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:05.726Dshadowstrike
[build]
Fluffy_Pillow 99.7/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:06.729Ishadow_blades
[cds]
Combo 1 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:06.729Mcoup_de_grace
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:07.932Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
3:08.937Neviscerate
[finish]
Fluffy_Pillow 75.2/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_buff(24), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:09.940Neviscerate
[finish]
Fluffy_Pillow 95.3/100 95% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:10.944Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:11.949Neviscerate
[finish]
Fluffy_Pillow 75.2/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:12.954Neviscerate
[finish]
Fluffy_Pillow 95.4/100 95% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:13.958Hsymbols_of_death
[cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(5), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:13.958Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:13.958Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(10), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:14.962Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:15.967Fcold_blood
[cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:15.967Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:16.973Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(9), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:17.978Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, storm_sewers_citrine
3:18.983Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
3:19.987Mcoup_de_grace
[finish]
Fluffy_Pillow 52.2/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:21.192Dshadowstrike
[build]
Fluffy_Pillow 98.9/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:22.198Lrupture
[finish]
Fluffy_Pillow 65.3/100 65% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:23.201Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:24.204Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:25.208Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:26.212Hsymbols_of_death
[cds]
Combo 1 90.8/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_haste
3:26.212Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:26.212Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:27.216Neviscerate
[finish]
Fluffy_Pillow 66.4/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:28.220Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:29.225Ksecret_technique
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(5), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:30.229Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(7), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:31.232Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:32.235Dshadowstrike
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(7), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:33.240Neviscerate
[finish]
Fluffy_Pillow 68.2/100 68% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:34.245Ebackstab
[build]
Fluffy_Pillow 79.1/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:35.249Neviscerate
[finish]
Fluffy_Pillow 49.9/100 50% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_vers
3:36.253Ebackstab
[build]
Fluffy_Pillow 55.7/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:37.395Ebackstab
[build]
Fluffy_Pillow 43.9/100 44% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:39.610Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:40.615Ebackstab
[build]
Fluffy_Pillow 49.5/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
3:42.808Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
3:45.713Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:46.719Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:49.158Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:50.162Hsymbols_of_death
[cds]
Combo 1 12.1/100 12% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:50.162Qshadow_dance
[stealth_cds]
Combo 1 52.1/100 52% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:50.162Ksecret_technique
[finish]
Fluffy_Pillow 52.1/100 52% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form, premeditation, the_rotten(2), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:51.230Dshadowstrike
[build]
Fluffy_Pillow 86.6/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:52.234Mcoup_de_grace
[finish]
Fluffy_Pillow 60.4/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:53.439Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:54.446Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:55.451Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_vers
3:56.455Neviscerate
[finish]
Fluffy_Pillow 58.7/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:57.459Dshadowstrike
[build]
Fluffy_Pillow 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:58.462Lrupture
[finish]
Fluffy_Pillow 52.3/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:59.466Ebackstab
[build]
Fluffy_Pillow 81.6/100 82% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:00.472Ebackstab
[build]
Fluffy_Pillow 53.0/100 53% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:01.779Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:02.783Ebackstab
[build]
Fluffy_Pillow 50.1/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
4:04.746Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:07.151Ksecret_technique
[finish]
Fluffy_Pillow 31.6/100 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:08.157Rvanish
[stealth_cds]
Combo 1 52.0/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:08.157Dshadowstrike
[build]
Fluffy_Pillow 52.0/100 52% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:10.198Neviscerate
[finish]
Fluffy_Pillow 38.1/100 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:11.200Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:13.186Mcoup_de_grace
[finish]
Fluffy_Pillow 35.9/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:14.391Ebackstab
[build]
Fluffy_Pillow 69.6/100 70% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:15.395Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
4:18.300Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
4:21.171Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
4:22.177Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
4:24.953Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:28.206Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:30.073Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:31.076Ebackstab
[build]
Fluffy_Pillow 51.7/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques(2), windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:32.081Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 23.1/100 23% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:33.404Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, windsingers_runed_citrine_Vers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:34.408Jflagellation
[cds]
Fluffy_Pillow 13.5/100 14% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, windsingers_runed_citrine_Vers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.413Hsymbols_of_death
[cds]
Combo 1 28.9/100 29% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, windsingers_runed_citrine_Vers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.413Qshadow_dance
[stealth_cds]
Combo 1 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, windsingers_runed_citrine_Vers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.413Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, windsingers_runed_citrine_Vers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:35.413Ksecret_technique
[finish]
Fluffy_Pillow 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:36.418Dshadowstrike
[build]
Fluffy_Pillow 98.3/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:37.422Ishadow_blades
[cds]
Combo 1 72.7/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:37.422Neviscerate
[finish]
Fluffy_Pillow 72.7/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:38.426Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:39.430Neviscerate
[finish]
Fluffy_Pillow 66.6/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(19), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:40.435Neviscerate
[finish]
Fluffy_Pillow 86.3/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:41.439Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
4:42.443Mcoup_de_grace
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:43.647Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:44.651Neviscerate
[finish]
Fluffy_Pillow 71.1/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:45.655Hsymbols_of_death
[cds]
Combo 1 82.2/100 82% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques, flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:45.655Qshadow_dance
[stealth_cds]
Combo 1 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:45.655Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(10), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:46.658Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(10), premeditation, shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:47.664Fcold_blood
[cds]
Combo 1 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:47.664Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:48.669Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(9), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:49.673Neviscerate
[finish]
Fluffy_Pillow 66.1/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(10), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:50.677Neviscerate
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:51.680Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:52.685Neviscerate
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:53.690Neviscerate
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:54.694Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:55.699Neviscerate
[finish]
Fluffy_Pillow 79.1/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:56.702Ebackstab
[build]
Fluffy_Pillow 93.2/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:57.706Ebackstab
[build]
Fluffy_Pillow 64.2/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:58.709Mcoup_de_grace
[finish]
Fluffy_Pillow 43.3/100 43% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
4:59.913Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.79%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery78.39%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 1"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 2 : 1,465,772 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,465,772.31,465,772.32,893.6 / 0.197%195,240.4 / 13.3%48,685.0
Resource Out In Waiting APM Active
Energy30.129.910.95%57.5100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 21,465,772
Auto Attack 0 (70,620)0.0% (4.8%)3.9122.66s5,375,3550

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 47,1863.2%358.90.97s39,25840,805Direct358.938,15676,91139,25518.8%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage358.87358.870.000.000.000.96210.000014,088,445.6918,382,492.7523.36%40,804.9740,804.97
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.90%232.9017230338,155.6023,37064,33538,160.8735,87440,4138,885,93211,595,43823.37%
crit18.85%67.653410376,911.1347,667128,86276,930.8969,81784,5065,202,5146,787,05523.35%
miss16.25%58.3231860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,4341.6%358.60.97s19,51720,219Direct358.618,99938,25119,52318.8%16.3%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage358.56358.560.000.000.000.96530.00006,998,001.539,131,253.3623.36%20,219.0720,219.07
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.89%232.6517130518,999.2511,51032,04719,000.0618,09120,0954,419,9715,767,88123.37%
crit18.80%67.414010038,250.9323,70864,19038,254.6734,97742,2682,578,0303,363,37223.35%
miss16.31%58.5033920.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,2652.1%75.83.65s119,500118,966Direct75.872,659188,200119,51340.5%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.7975.790.000.000.001.00450.00009,056,654.9211,849,972.7023.57%118,966.15118,966.15
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.46%45.06256972,659.2354,117142,41772,648.4167,89577,9853,274,0874,286,42923.61%
crit40.54%30.721551188,199.69121,841432,118188,305.59173,514212,6805,782,5687,563,54323.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.80

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 88,873 (126,838)6.1% (8.7%)13.322.16s2,843,5402,360,790Direct39.9 (78.3)515,9651,031,281665,32929.0% (28.9%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3239.890.000.000.001.20450.000026,530,778.4134,540,860.3923.19%2,360,790.312,360,790.31
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.03%28.331645515,965.47115,8722,016,588515,615.00356,017732,13714,607,99019,020,21323.20%
crit28.97%11.553261,031,280.79237,0153,728,7671,031,989.33321,7731,879,25811,922,78815,520,64823.19%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.32
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,9652.6%0.00.00s00Direct38.4228,528459,634295,27628.9%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.400.000.000.000.00000.000011,336,298.1711,336,298.170.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.12%27.311643228,527.5354,406874,868228,500.09148,693347,9736,238,8066,238,8060.00%
crit28.88%11.09222459,634.41108,9751,517,105461,367.10233,428927,3185,097,4925,097,4920.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,784)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,7841.4%22.013.19s268,7180Direct22.0268,8380268,8380.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.0122.000.000.000.000.00000.00005,915,167.735,915,167.730.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.001036268,837.85260,578310,342268,812.95262,602279,1465,915,1685,915,1680.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 253,754 (362,954)17.3% (24.8%)69.24.30s1,565,2511,558,259Direct69.2 (137.1)842,0961,732,4621,094,44728.4% (28.3%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage69.2069.200.000.000.001.00450.000075,719,451.7998,497,792.5423.13%1,558,258.691,558,258.69
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.63%49.573167842,096.15204,0442,615,642841,566.94705,9511,063,34341,728,52754,283,74523.13%
crit28.37%19.637351,732,461.61409,9394,733,2971,730,922.931,096,7672,458,09833,990,92544,214,04723.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:69.20

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 109,2007.4%67.94.38s479,9720Direct67.9370,387758,032480,05528.3%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.9067.900.000.000.000.00000.000032,591,993.0332,591,993.030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.71%48.693267370,387.2397,2771,134,759370,323.81302,421463,59718,025,98018,025,9800.00%
crit28.29%19.21836758,032.12194,8452,034,494759,260.95491,9351,027,74314,566,01314,566,0130.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,009 (20,802)0.1% (1.4%)3.791.39s1,685,6361,678,268Direct3.7 (27.6)68,880136,79781,53518.6% (19.1%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.693.690.000.000.001.00450.0000300,558.87300,558.870.00%1,678,267.661,678,267.66
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.37%3.000468,880.0758,955137,56568,766.020101,560206,604206,6040.00%
crit18.63%0.6903136,797.13118,087260,81873,847.140260,81893,95593,9550.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.69
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 19,7941.4%0.00.00s00Direct23.9207,652416,286247,52419.1%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.890.000.000.000.00000.00005,912,387.995,912,387.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.88%19.32927207,652.1177,276459,181207,319.55170,472250,2244,010,7544,010,7540.00%
crit19.12%4.57011416,285.94153,212892,134415,761.460806,5721,901,6341,901,6340.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2200.8%0.00.00s00Direct285.810,72121,56712,76818.9%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00285.790.000.000.000.00000.00003,648,712.633,648,712.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.12%231.8415831610,721.467,11717,56110,721.1310,12011,4422,485,4332,485,4330.00%
crit18.88%53.95288721,566.5814,25535,17421,568.8219,12523,9061,163,2791,163,2790.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,575 (116,696)6.7% (8.0%)9.531.46s3,676,3433,659,991Periodic169.2 (338.4)134,057277,420173,96327.8% (27.8%)0.0%97.1%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.480.00169.21169.217.031.00451.713729,430,613.1129,430,613.110.00%116,328.123,659,991.24
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.16%122.1086158134,057.49117440,364134,107.21119,406155,32316,367,11916,367,1190.00%
crit27.84%47.111975277,420.19509804,200277,376.40209,944346,42013,063,49413,063,4940.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.48
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1211.2%169.21.74s31,9650Periodic169.224,64050,99931,97027.8%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage169.210.000.00169.210.000.00000.00005,408,843.465,408,843.460.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.18%122.148516824,640.389,15980,74524,646.4522,14328,8423,009,1763,009,1760.00%
crit27.82%47.07267250,999.1618,744152,70251,037.5836,20766,3512,399,6682,399,6680.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (268,022)0.0% (18.3%)16.018.81s4,985,2404,962,994

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.040.000.000.000.001.00450.00000.000.000.00%4,962,994.054,962,994.05

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:16.04
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 68,7424.7%0.00.00s00Direct16.0669,4832,085,5471,279,48143.1%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0016.040.000.000.000.00000.000020,514,962.7126,750,099.6623.31%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.93%9.13415669,483.41148,8381,752,036669,857.29393,891914,7286,112,0497,994,61823.56%
crit43.07%6.913142,085,547.38292,8143,983,9072,122,612.581,408,8623,152,51414,402,91418,755,48223.20%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 199,28013.6%0.00.00s00Direct32.0971,3722,995,0141,859,31343.8%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0032.010.000.000.000.00000.000059,463,686.4859,463,686.480.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.15%17.97927971,372.40215,1042,533,653971,833.90695,5261,217,45217,452,76417,452,7640.00%
crit43.85%14.036222,995,013.67465,9695,761,2023,024,816.652,059,8154,560,12542,010,92242,010,9220.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (103,401)0.0% (7.1%)3.690.86s8,507,4580

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.630.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.63
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 103,4017.1%388.01.17s79,5920Periodic388.079,593079,5930.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage388.020.000.00388.020.000.00000.000030,883,447.0930,883,447.090.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%388.0228847679,592.831371,073,51179,631.1368,57392,47130,883,44730,883,4470.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8953.89
  • base_dd_max:8953.89
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 116,7108.0%52.25.78s666,203663,225Direct52.2278,011909,513666,32161.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2252.220.000.000.001.00450.000034,791,464.5745,369,937.4823.32%663,225.14663,225.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.51%20.111231278,011.06126,049407,384277,882.97244,227310,7935,590,1077,282,18223.24%
crit61.49%32.111944909,513.42277,7621,384,754910,109.69831,811991,43629,201,35838,087,75623.33%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.22

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spidersting 7,4020.5%11.020.17s202,7750Periodic87.121,62143,11825,56318.4%0.0%25.3%

Stats Details: Spidersting

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.970.0087.1087.102.980.00000.86792,225,246.552,225,246.550.00%29,439.540.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit81.64%71.102615521,621.1154144,93621,235.9114,64746,7411,535,9851,535,9850.00%
crit18.36%15.9923943,117.64274290,30742,284.2424,10998,007689,261689,2610.00%

Action Details: Spidersting

  • id:452229
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:12050.66
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:452229
  • name:Spidersting
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every second.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
Squall Sailor's Citrine 3,7070.3%2.467.64s470,3730Direct2.4397,884797,009471,01118.3%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.00001,110,063.941,110,063.940.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.72%1.9308397,883.59377,346479,652345,431.750472,860766,516766,5160.00%
crit18.28%0.4303797,008.56755,824928,602272,532.630916,517343,548343,5480.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8210.1%2.374.49s108,3530Direct2.390,522182,661108,26319.3%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000244,328.24244,328.240.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.65%1.820690,521.7383,958119,53376,695.820111,892164,599164,5990.00%
crit19.35%0.4403182,660.50168,168228,51163,738.560228,51179,72979,7290.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67871.49
  • base_dd_max:67871.49
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,8313.3%19.414.49s737,5520Periodic107.8132,4750132,4750.0%0.0%72.2%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.380.00107.84107.8412.470.00002.000014,292,885.6214,292,885.620.00%66,268.940.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.8464163132,474.8760,995218,418131,749.6670,083172,22314,292,88614,292,8860.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 68,7164.7%35.08.35s587,4310Direct35.0494,649991,085587,30218.7%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage34.9634.960.000.000.000.00000.000020,539,502.2720,539,502.270.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.32%28.431448494,648.88453,001860,525494,478.66466,319533,50014,064,66814,064,6680.00%
crit18.68%6.53016991,084.93907,3601,694,580989,281.9901,509,2016,474,8346,474,8340.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4530.3%2.376.87s571,3870Direct2.3477,419956,309570,86119.6%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.332.330.000.000.000.00000.00001,333,064.311,333,064.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.38%1.88010477,419.02452,539568,490405,343.870568,490895,167895,1670.00%
crit19.62%0.4605956,309.24906,4361,180,093341,854.1201,180,093437,897437,8970.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 84,5305.8%58.25.12s433,6600Direct58.2365,217735,296433,69618.5%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage58.1958.190.000.000.000.00000.000025,234,397.1432,968,234.4023.46%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.49%47.423164365,216.90209,149560,233365,255.10334,978398,69017,314,77922,622,75923.46%
crit18.51%10.77223735,295.69420,1951,106,661736,419.23532,250927,9697,919,61810,345,47523.45%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.590.73s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.540.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.54
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.19s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.700.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.711.23s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.372.75s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.330.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.463.55s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.390.0070.390.000.300.00000.83440.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5308.53s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.460.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.46
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.43.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.365.98s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.04s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.30
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
arakara_sacbrood 11.020.17s

Stats Details: Spiderfling

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.980.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Spiderfling

  • id:452227
  • school:physical
  • range:100.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452227
  • name:Spiderfling
  • school:physical
  • tooltip:
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.374.49s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.252.250.000.000.000.00000.00000.001,537,133.930.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.25070.00000.000001,537,13489.41%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8210.1%2.374.49s108,3530Direct2.390,522182,661108,26319.3%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.252.250.000.000.000.00000.0000244,328.24244,328.240.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.65%1.820690,521.7383,958119,53376,695.820111,892164,599164,5990.00%
crit19.35%0.4403182,660.50168,168228,51163,738.560228,51179,72979,7290.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:67871.49
  • base_dd_max:67871.49
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.221.27s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.230.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.23
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.66s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.920.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 2
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.92
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.465.08s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.360.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1599.5171.8s0.5s276.7s99.94%100.00%589.8 (589.8)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:9.1s / 344.9s
  • trigger_min/max:0.0s / 4.2s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 359.9s
  • uptime_min/max:99.15% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.22%
  • acrobatic_strikes_2:0.22%
  • acrobatic_strikes_3:0.21%
  • acrobatic_strikes_4:0.17%
  • acrobatic_strikes_5:0.16%
  • acrobatic_strikes_6:0.15%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.15%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.36%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.282.9119.9s3.5s133.3s97.38%0.00%74.9 (77.8)1.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 353.1s
  • trigger_min/max:1.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 357.7s
  • uptime_min/max:86.97% / 99.44%

Stack Uptimes

  • alacrity_1:2.75%
  • alacrity_2:2.05%
  • alacrity_3:1.69%
  • alacrity_4:1.61%
  • alacrity_5:89.28%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.57%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.22%100.00%0.0 (0.0)15.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.78% / 40.80%

Stack Uptimes

  • bolstering_shadows_1:37.22%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.50.090.6s90.6s0.1s0.00%1.40%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:82.5s / 99.0s
  • trigger_min/max:82.5s / 99.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0129.0s114.6s4.3s1.78%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.3s
  • trigger_min/max:90.0s / 187.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s
  • uptime_min/max:0.00% / 6.56%

Stack Uptimes

  • cryptic_instructions_1:1.78%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.348.023.1s23.1s8.2s36.60%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 68.6s
  • trigger_min/max:8.0s / 68.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.82% / 39.31%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.56%
  • danse_macabre_3:6.59%
  • danse_macabre_4:16.59%
  • danse_macabre_5:8.80%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.575.041.4s3.6s36.1s90.57%95.87%75.0 (75.0)6.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 174.4s
  • trigger_min/max:1.0s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 152.7s
  • uptime_min/max:76.61% / 96.36%

Stack Uptimes

  • deeper_daggers_1:90.57%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.52%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.03% / 21.09%

Stack Uptimes

  • disorienting_strikes_1:12.25%
  • disorienting_strikes_2:6.26%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Egg Sac13.90.0135.2s20.2s236.9s92.87%0.00%0.0 (0.0)0.2

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_egg_sac
  • max_stacks:99
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1401.18

Trigger Details

  • interval_min/max:0.1s / 353.7s
  • trigger_min/max:0.1s / 89.4s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 355.5s
  • uptime_min/max:70.12% / 99.81%

Stack Uptimes

  • egg_sac_1:19.25%
  • egg_sac_2:27.94%
  • egg_sac_3:22.55%
  • egg_sac_4:13.30%
  • egg_sac_5:6.16%
  • egg_sac_6:2.44%
  • egg_sac_7:0.85%
  • egg_sac_8:0.32%
  • egg_sac_9:0.11%
  • egg_sac_10:0.07%

Spelldata

  • id:452146
  • name:Egg Sac
  • tooltip:Overcome by parental instinct, you gain {$=}w1 {$=}pri to protect your brood.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
  • max_stacks:99
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Errant Manaforge Emission1.20.0129.6s109.4s4.0s1.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.6s
  • trigger_min/max:90.0s / 187.6s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 10.3s
  • uptime_min/max:0.00% / 7.37%

Stack Uptimes

  • errant_manaforge_emission_1:1.67%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.144.122.0s5.1s17.3s81.71%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.2s / 60.5s
  • trigger_min/max:1.0s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.1s
  • uptime_min/max:66.70% / 92.47%

Stack Uptimes

  • escalating_blade_1:25.17%
  • escalating_blade_2:22.16%
  • escalating_blade_3:22.68%
  • escalating_blade_4:11.70%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.14%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.9s / 184.0s
  • trigger_min/max:83.9s / 184.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.64% / 20.89%

Stack Uptimes

  • ethereal_powerlink_1:18.14%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.283.7s71.7s15.3s10.69%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4399.55

Trigger Details

  • interval_min/max:15.1s / 322.4s
  • trigger_min/max:1.0s / 322.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 37.7s
  • uptime_min/max:0.00% / 34.85%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.69%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.091.3s9.6s11.8s14.61%0.00%14.5 (97.1)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.5s
  • trigger_min/max:1.0s / 87.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.86% / 16.89%

Stack Uptimes

  • flagellation_buff_1:1.31%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.64%
  • flagellation_buff_10:0.54%
  • flagellation_buff_11:0.45%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.01%
  • flagellation_buff_17:0.03%
  • flagellation_buff_18:0.03%
  • flagellation_buff_19:0.44%
  • flagellation_buff_20:0.37%
  • flagellation_buff_21:0.29%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.21%
  • flagellation_buff_25:0.83%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.18%
  • flagellation_buff_28:0.18%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.15%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.20%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.3s / 98.5s
  • trigger_min/max:78.3s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.28% / 16.25%

Stack Uptimes

  • flagellation_persist_16:0.00%
  • flagellation_persist_23:0.00%
  • flagellation_persist_30:14.19%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s77.5s35.2s24.93%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.4s / 335.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 74.59%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.93%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.7112.7s75.3s36.0s25.35%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 79.22%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.35%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.9s77.0s35.2s25.14%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 85.37%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.17%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6113.2s77.9s35.2s24.57%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 320.9s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 159.4s
  • uptime_min/max:0.00% / 76.45%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.57%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.50.040.3s3.4s60.0s95.32%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.66%
  • flawless_form_2:8.65%
  • flawless_form_3:11.60%
  • flawless_form_4:9.68%
  • flawless_form_5:2.66%
  • flawless_form_6:4.36%
  • flawless_form_7:5.82%
  • flawless_form_8:11.26%
  • flawless_form_9:18.65%
  • flawless_form_10:9.11%
  • flawless_form_11:1.51%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.17%
  • flawless_form_16:0.09%
  • flawless_form_17:0.02%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Poised Shadows13.80.422.0s21.3s3.6s16.93%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 83.2s
  • trigger_min/max:1.0s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.0s
  • uptime_min/max:9.32% / 26.94%

Stack Uptimes

  • poised_shadows_1:16.93%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.8s18.8s1.1s2.63%11.18%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 66.4s
  • trigger_min/max:1.0s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.40% / 4.58%

Stack Uptimes

  • premeditation_1:2.63%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0129.0s112.5s3.9s1.62%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.3s
  • trigger_min/max:90.0s / 188.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 10.9s
  • uptime_min/max:0.00% / 6.61%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.63%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.20.283.0s71.0s15.4s11.12%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.1s / 315.6s
  • trigger_min/max:1.0s / 315.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 47.1s
  • uptime_min/max:0.00% / 38.71%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:11.12%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.8s90.8s15.8s19.17%16.97%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.2s
  • trigger_min/max:90.0s / 98.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:16.88% / 21.90%

Stack Uptimes

  • shadow_blades_1:19.17%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.60%100.00%0.0 (0.0)13.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 68.6s
  • trigger_min/max:8.0s / 68.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.82% / 39.31%

Stack Uptimes

  • shadow_dance_1:36.60%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.5140.94.4s1.4s3.5s79.25%95.57%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 44.2s
  • trigger_min/max:0.5s / 7.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.8s
  • uptime_min/max:72.60% / 86.14%

Stack Uptimes

  • shadow_techniques_1:20.63%
  • shadow_techniques_2:20.64%
  • shadow_techniques_3:9.45%
  • shadow_techniques_4:10.51%
  • shadow_techniques_5:6.09%
  • shadow_techniques_6:5.89%
  • shadow_techniques_7:2.60%
  • shadow_techniques_8:2.36%
  • shadow_techniques_9:0.54%
  • shadow_techniques_10:0.47%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s296.8s99.32%85.69%98.4 (98.4)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Spiderling10.90.120.2s20.1s0.4s1.61%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_spiderling
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 89.4s
  • trigger_min/max:0.5s / 89.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.6s
  • uptime_min/max:0.34% / 4.11%

Stack Uptimes

  • spiderling_1:1.61%
  • spiderling_2:0.01%

Spelldata

  • id:452226
  • name:Spiderling
  • tooltip:A new brood is ready to attack!
  • description:Casting a harmful spell or ability launches one of your spiderlings at the enemy inflicting {$443541s2=6209} Nature damage over $12096d.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.0106.5s98.8s9.9s1.43%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:11.3s / 330.6s
  • trigger_min/max:6.0s / 330.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.7s
  • uptime_min/max:0.00% / 11.42%

Stack Uptimes

  • storm_sewers_citrine_1:1.43%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0106.3s96.8s9.8s1.55%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:5.0s / 305.5s
  • trigger_min/max:2.9s / 305.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.0s
  • uptime_min/max:0.00% / 12.81%

Stack Uptimes

  • storm_sewers_citrine_1:1.55%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0102.2s90.8s9.9s1.62%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 305.7s
  • trigger_min/max:1.9s / 305.7s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 19.0s
  • uptime_min/max:0.00% / 12.08%

Stack Uptimes

  • storm_sewers_citrine_1:1.62%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0101.2s97.5s9.9s1.70%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:3.0s / 298.1s
  • trigger_min/max:1.0s / 298.1s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 18.2s
  • uptime_min/max:0.00% / 12.46%

Stack Uptimes

  • storm_sewers_citrine_1:1.70%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.283.0s70.1s15.4s10.86%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1430.02
  • stat:haste_rating
  • amount:1430.02
  • stat:mastery_rating
  • amount:1430.02
  • stat:versatility_rating
  • amount:1430.02

Trigger Details

  • interval_min/max:15.1s / 288.8s
  • trigger_min/max:0.3s / 286.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:0.00% / 35.36%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.86%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s10.96%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 62.5s
  • trigger_min/max:3.0s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:9.06% / 16.73%

Stack Uptimes

  • supercharge_1_1:10.96%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.07%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 62.5s
  • trigger_min/max:1.0s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s
  • uptime_min/max:0.75% / 7.72%

Stack Uptimes

  • supercharge_2_1:2.07%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s0.9s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.0s
  • uptime_min/max:0.00% / 0.68%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.36.944.1s21.3s24.8s61.17%100.00%6.9 (6.9)6.8

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.1s / 96.1s
  • trigger_min/max:1.0s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:58.04% / 65.10%

Stack Uptimes

  • symbols_of_death_1:61.17%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0308.0s308.0s27.7s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.4s
  • trigger_min/max:300.0s / 329.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.97% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.80%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.40% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.86%22.15%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 62.5s
  • trigger_min/max:1.0s / 62.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:11.23% / 17.21%

Stack Uptimes

  • the_rotten_1:10.81%
  • the_rotten_2:3.04%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.07%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 134.3s
  • trigger_min/max:120.0s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.38%

Stack Uptimes

  • vanish_1:0.07%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.0100.8s32.7s15.2s0.30%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4606.66

Trigger Details

  • interval_min/max:29.8s / 171.8s
  • trigger_min/max:3.2s / 171.8s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 23.0s
  • uptime_min/max:0.00% / 9.03%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.36%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.282.8s69.7s15.5s10.66%0.00%0.2 (0.2)1.9

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.0s / 321.0s
  • trigger_min/max:1.0s / 319.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 39.3s
  • uptime_min/max:0.00% / 35.74%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.66%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.926.079.05.9s0.7s67.2s
Skyfury (Off Hand)50.127.081.05.9s0.7s61.4s
Supercharger secret_technique12.47.017.023.5s9.2s89.9s
Cold Blood secret_technique3.53.04.090.6s82.5s99.0s
Supercharger rupture0.30.02.0179.0s31.9s275.1s
Supercharger coup_de_grace2.90.09.076.8s9.2s324.7s
Supercharger eviscerate12.84.020.023.4s1.0s137.2s
CP Spent During Flagellation202.4144.0246.011.1s1.0s91.3s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.83%6.28%13.49%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 2
Energy RegenEnergy1,464.403,057.2834.22%2.09421.4512.12%
Improved AmbushCombo Points52.2233.574.56%0.6418.6435.70%
PremeditationCombo Points17.2057.077.75%3.3263.3652.61%
Relentless StrikesEnergy108.044,288.8148.00%39.70130.682.96%
Shadow BladesCombo Points21.75112.9215.34%5.1917.5813.47%
Shadow TechniquesEnergy364.501,241.8313.90%3.41216.1814.83%
Shadow TechniquesCombo Points86.26242.8832.99%2.820.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.70109.8714.92%7.000.000.00%
BackstabCombo Points75.8075.4910.25%1.000.310.41%
ShadowstrikeCombo Points52.22104.3914.18%2.000.040.04%
Symbols of DeathEnergy14.23347.023.88%24.39222.1839.03%
Usage Type Count Total Tot% Avg RPE APR
Combo 2
BackstabEnergy75.803,031.9033.73%40.0040.002,987.12
Coup de GraceEnergy13.32466.135.19%35.0035.0081,237.53
Coup de GraceCombo Points13.3291.0612.43%6.846.84415,870.09
EviscerateEnergy69.202,422.0926.95%35.0035.0044,718.23
EviscerateCombo Points69.20471.7264.42%6.826.82229,610.35
RuptureEnergy9.48236.942.64%25.0025.00147,036.09
RuptureCombo Points9.4864.838.85%6.846.84537,394.05
Secret TechniqueEnergy16.04481.255.35%30.0030.00166,188.63
Secret TechniqueCombo Points16.04104.6514.29%6.526.52764,261.24
ShadowstrikeEnergy52.222,349.7126.14%45.0044.9914,806.70
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.9030.08990.347.00.1100.0
Combo Points0.02.462.4599.93.90.07.0

Statistics & Data Analysis

Fight Length
Combo 2 Fight Length
Count 1114
Mean 298.78
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Combo 2 Damage Per Second
Count 1114
Mean 1465772.34
Minimum 1307956.00
Maximum 1621572.89
Spread ( max - min ) 313616.89
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 49276.1070
5th Percentile 1386934.41
95th Percentile 1548987.69
( 95th Percentile - 5th Percentile ) 162053.27
Mean Distribution
Standard Deviation 1476.3652
95.00% Confidence Interval ( 1462878.71 - 1468665.96 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4342
0.1 Scale Factor Error with Delta=300 20727955
0.05 Scale Factor Error with Delta=300 82911819
0.01 Scale Factor Error with Delta=300 2072795457
Priority Target DPS
Combo 2 Priority Target Damage Per Second
Count 1114
Mean 1465772.34
Minimum 1307956.00
Maximum 1621572.89
Spread ( max - min ) 313616.89
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 49276.1070
5th Percentile 1386934.41
95th Percentile 1548987.69
( 95th Percentile - 5th Percentile ) 162053.27
Mean Distribution
Standard Deviation 1476.3652
95.00% Confidence Interval ( 1462878.71 - 1468665.96 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4342
0.1 Scale Factor Error with Delta=300 20727955
0.05 Scale Factor Error with Delta=300 82911819
0.01 Scale Factor Error with Delta=300 2072795457
DPS(e)
Combo 2 Damage Per Second (Effective)
Count 1114
Mean 1465772.34
Minimum 1307956.00
Maximum 1621572.89
Spread ( max - min ) 313616.89
Range [ ( max - min ) / 2 * 100% ] 10.70%
Damage
Combo 2 Damage
Count 1114
Mean 437570956.24
Minimum 342930801.79
Maximum 545329787.31
Spread ( max - min ) 202398985.52
Range [ ( max - min ) / 2 * 100% ] 23.13%
DTPS
Combo 2 Damage Taken Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 2 Healing Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 2 Healing Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 2 Heal
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 2 Healing Taken Per Second
Count 1114
Mean 3145.54
Minimum 0.00
Maximum 10701.01
Spread ( max - min ) 10701.01
Range [ ( max - min ) / 2 * 100% ] 170.10%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.22 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.80 backstab
actions.cds
# count action,conditions
F 3.54 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.46 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.23 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.63 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.69 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 16.04 secret_technique,if=variable.secret
L 9.48 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.32 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 69.20 eviscerate
actions.item
# count action,conditions
O 3.71 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.68 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.30 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.92 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDNHNDMQFKDNDNNDNENEEHQNDKDMDNDLENEEEHNQDKDNDNDMEENENHENEKEEELEENENEENEEEMEEOJHQKDPNDINDMNELNQDFKHDNNDNNENENEENEENRDLEEHQKDMDNDDNEENNEEEKEEMEEELEENEEENOEEJHQPKDINDMDNNELHQDFKNDNDNDNNEEHQNDKDMDNDNEENEELEENEHEQKDNDMDNEENENRDKEELEEEMEENEEOEJHQPNDIKNDNDNNELHQDMFKDNDNDNEEMEN

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Gpotion
[cds]
Fluffy_Pillow 68.7/100 69% energy
7.0/7 100% CP
bloodlust, flawless_form, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Jflagellation
[cds]
Fluffy_Pillow 68.7/100 69% energy
7.0/7 100% CP
bloodlust, flawless_form, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.008Neviscerate
[finish]
Fluffy_Pillow 86.9/100 87% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Rvanish
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(5), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.014Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(5), flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.019Lrupture
[finish]
Fluffy_Pillow 69.2/100 69% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(6), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Hsymbols_of_death
[cds]
Combo 2 97.9/100 98% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(9), alacrity, flawless_form, shadow_techniques(3), the_first_dance, flagellation_buff(15), deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(3), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, tempered_potion
0:05.024Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(9), alacrity, supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:06.030Ishadow_blades
[cds]
Combo 2 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:06.030Ksecret_technique
[finish]
Fluffy_Pillow 77.7/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form, shadow_techniques(5), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:07.035Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(7), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:08.041Neviscerate
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(9), flagellation_buff(25), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:09.048Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, tempered_potion
0:10.053Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:11.059Neviscerate
[finish]
Fluffy_Pillow 70.1/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:12.065Dshadowstrike
[build]
Fluffy_Pillow 93.3/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:13.070Neviscerate
[finish]
Fluffy_Pillow 71.4/100 71% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(3), shadow_techniques(10), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:14.074Hsymbols_of_death
[cds]
Combo 2 86.7/100 87% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:14.074Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:15.077Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(3), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:16.082Mcoup_de_grace
[finish]
Fluffy_Pillow 78.3/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(4), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:17.287Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:17.287Fcold_blood
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:17.287Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(9), premeditation, shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:18.290Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:19.294Neviscerate
[finish]
Fluffy_Pillow 78.2/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit, tempered_potion
0:20.297Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:21.300Neviscerate
[finish]
Fluffy_Pillow 69.9/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:22.304Neviscerate
[finish]
Fluffy_Pillow 92.9/100 93% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:23.308Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit, tempered_potion
0:24.312Neviscerate
[finish]
Fluffy_Pillow 77.9/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:25.315Ebackstab
[build]
Fluffy_Pillow 92.9/100 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:26.320Neviscerate
[finish]
Fluffy_Pillow 75.8/100 76% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, tempered_potion
0:27.324Ebackstab
[build]
Fluffy_Pillow 93.8/100 94% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(4), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:28.329Ebackstab
[build]
Fluffy_Pillow 68.8/100 69% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:29.334Hsymbols_of_death
[cds]
Combo 2 43.7/100 44% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:29.334Qshadow_dance
[stealth_cds]
Combo 2 83.7/100 84% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), the_rotten(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:29.334Neviscerate
[finish]
Fluffy_Pillow 83.7/100 84% energy
6.0/7 86% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, the_rotten(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:30.338Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_crit, tempered_potion
0:31.341Ksecret_technique
[finish]
Fluffy_Pillow 69.7/100 70% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
0:32.347Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
0:33.352Mcoup_de_grace
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
0:34.556Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_crit
0:35.560Neviscerate
[finish]
Fluffy_Pillow 85.4/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_crit
0:36.565Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_crit
0:37.568Lrupture
[finish]
Fluffy_Pillow 77.4/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_crit
0:38.574Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_crit
0:39.577Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:40.581Ebackstab
[build]
Fluffy_Pillow 94.8/100 95% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:41.585Ebackstab
[build]
Fluffy_Pillow 65.8/100 66% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:42.591Ebackstab
[build]
Fluffy_Pillow 44.9/100 45% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:44.612Hsymbols_of_death
[cds]
Combo 2 35.0/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:44.612Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:45.616Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:45.616Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, egg_sac(2), flask_of_alchemical_chaos_vers
0:46.621Ksecret_technique
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_vers
0:47.626Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(8), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_vers
0:48.632Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_vers
0:49.637Dshadowstrike
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_vers
0:50.639Neviscerate
[finish]
Fluffy_Pillow 59.1/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, egg_sac(4), flask_of_alchemical_chaos_vers
0:51.643Dshadowstrike
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, egg_sac(4), flask_of_alchemical_chaos_vers
0:52.647Mcoup_de_grace
[finish]
Fluffy_Pillow 44.1/100 44% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(4), flask_of_alchemical_chaos_vers
0:53.852Ebackstab
[build]
Fluffy_Pillow 90.4/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), deeper_daggers, egg_sac(4), flask_of_alchemical_chaos_vers
0:54.856Ebackstab
[build]
Fluffy_Pillow 69.4/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, egg_sac(5), flask_of_alchemical_chaos_vers
0:55.862Neviscerate
[finish]
Fluffy_Pillow 48.4/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, egg_sac(5), flask_of_alchemical_chaos_vers
0:56.866Ebackstab
[build]
Fluffy_Pillow 67.5/100 67% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, egg_sac(5), flask_of_alchemical_chaos_vers
0:57.872Neviscerate
[finish]
Fluffy_Pillow 46.5/100 47% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, egg_sac(5), flask_of_alchemical_chaos_vers
0:58.876Hsymbols_of_death
[cds]
Combo 2 52.5/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, egg_sac(5), flask_of_alchemical_chaos_vers
0:58.876Ebackstab
[build]
Fluffy_Pillow 92.5/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
0:59.882Neviscerate
[finish]
Fluffy_Pillow 71.6/100 72% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:00.885Ebackstab
[build]
Fluffy_Pillow 85.6/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:01.888Ksecret_technique
[finish]
Fluffy_Pillow 56.6/100 57% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), deeper_daggers, poised_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:02.891Ebackstab
[build]
Fluffy_Pillow 85.6/100 86% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, poised_shadows, bolstering_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:03.893Ebackstab
[build]
Fluffy_Pillow 56.6/100 57% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), deeper_daggers, bolstering_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:05.326Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:06.941Lrupture
[finish]
Fluffy_Pillow 26.1/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:07.946Ebackstab
[build]
Fluffy_Pillow 55.1/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), bolstering_shadows, egg_sac(5), flask_of_alchemical_chaos_vers
1:09.572Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), egg_sac(5), flask_of_alchemical_chaos_haste
1:11.115Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), stormbringers_runed_citrine_proc, egg_sac(5), flask_of_alchemical_chaos_haste
1:12.119Ebackstab
[build]
Fluffy_Pillow 55.2/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:13.123Neviscerate
[finish]
Fluffy_Pillow 35.1/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:14.129Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:15.985Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:18.554Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:19.559Ebackstab
[build]
Fluffy_Pillow 47.1/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:22.093Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:24.612Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Vers, egg_sac(5), flask_of_alchemical_chaos_haste
1:27.157Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(3), fathomdwellers_runed_citrine_proc, spiderling, egg_sac(3), flask_of_alchemical_chaos_haste
1:28.359Ebackstab
[build]
Fluffy_Pillow 79.2/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_haste
1:29.362Ebackstab
[build]
Fluffy_Pillow 50.9/100 51% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_haste
1:30.367Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 22.5/100 23% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_haste
1:30.918Jflagellation
[cds]
Fluffy_Pillow 32.9/100 33% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste
1:32.008Hsymbols_of_death
[cds]
Combo 2 45.5/100 46% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, flagellation_buff, deeper_daggers, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:32.008Qshadow_dance
[stealth_cds]
Combo 2 85.5/100 86% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:32.008Ksecret_technique
[finish]
Fluffy_Pillow 85.5/100 86% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:33.012Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(7), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:34.016Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, cryptic_instructions, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:34.016Neviscerate
[finish]
Fluffy_Pillow 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(5), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:35.021Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(8), shadow_techniques(7), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:36.025Ishadow_blades
[cds]
Combo 2 74.6/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:36.030Neviscerate
[finish]
Fluffy_Pillow 74.7/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:37.036Dshadowstrike
[build]
Fluffy_Pillow 94.4/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(7), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:38.040Mcoup_de_grace
[finish]
Fluffy_Pillow 69.0/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(9), flagellation_buff(27), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:39.244Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(4), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_haste, storm_sewers_citrine
1:40.247Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(6), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers, storm_sewers_citrine
1:41.253Lrupture
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:42.257Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:43.260Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:43.260Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(3), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:44.266Fcold_blood
[cds]
Combo 2 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:44.266Ksecret_technique
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:45.271Hsymbols_of_death
[cds]
Combo 2 94.6/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(5), flask_of_alchemical_chaos_vers
1:45.271Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes(2), flawless_form(8), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(5), flask_of_alchemical_chaos_vers
1:46.277Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, spiderling, egg_sac(4), flask_of_alchemical_chaos_vers
1:47.282Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:48.286Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(4), flask_of_alchemical_chaos_vers
1:49.291Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(4), flask_of_alchemical_chaos_vers
1:50.295Neviscerate
[finish]
Fluffy_Pillow 93.6/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(4), flask_of_alchemical_chaos_vers
1:51.300Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_vers
1:52.305Neviscerate
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_vers
1:53.309Ebackstab
[build]
Fluffy_Pillow 90.5/100 91% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_vers
1:54.312Neviscerate
[finish]
Fluffy_Pillow 69.6/100 70% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, spiderling, egg_sac(2), flask_of_alchemical_chaos_vers
1:55.316Ebackstab
[build]
Fluffy_Pillow 80.7/100 81% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
1:56.320Ebackstab
[build]
Fluffy_Pillow 59.7/100 60% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
1:57.326Neviscerate
[finish]
Fluffy_Pillow 38.8/100 39% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
1:58.331Ebackstab
[build]
Fluffy_Pillow 52.9/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(4), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:00.476Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:02.981Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:03.986Rvanish
[stealth_cds]
Combo 2 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:03.986Dshadowstrike
[build]
Fluffy_Pillow 47.3/100 47% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:05.810Lrupture
[finish]
Fluffy_Pillow 30.4/100 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(4), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:06.814Ebackstab
[build]
Fluffy_Pillow 51.5/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(4), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_vers
2:09.114Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_vers
2:10.119Hsymbols_of_death
[cds]
Combo 2 11.9/100 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:10.119Qshadow_dance
[stealth_cds]
Combo 2 51.9/100 52% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), the_rotten(2), deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:10.119Ksecret_technique
[finish]
Fluffy_Pillow 51.9/100 52% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(2), premeditation, the_rotten(2), deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:11.125Dshadowstrike
[build]
Fluffy_Pillow 90.9/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(4), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), poised_shadows, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:12.130Mcoup_de_grace
[finish]
Fluffy_Pillow 65.0/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(4), the_rotten, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:13.335Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:14.340Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:15.345Dshadowstrike
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:16.349Dshadowstrike
[build]
Fluffy_Pillow 51.1/100 51% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
2:17.571Neviscerate
[finish]
Fluffy_Pillow 35.5/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:18.575Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:20.238Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:22.272Neviscerate
[finish]
Fluffy_Pillow 39.1/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(7), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:23.276Neviscerate
[finish]
Fluffy_Pillow 54.2/100 54% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:24.279Ebackstab
[build]
Fluffy_Pillow 65.2/100 65% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:25.729Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:28.644Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:30.651Ksecret_technique
[finish]
Fluffy_Pillow 31.1/100 31% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, egg_sac(3), flask_of_alchemical_chaos_crit
2:31.656Ebackstab
[build]
Fluffy_Pillow 46.2/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(3), bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
2:34.508Ebackstab
[build]
Fluffy_Pillow 41.5/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
2:36.931Mcoup_de_grace
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_crit
2:38.135Ebackstab
[build]
Fluffy_Pillow 73.3/100 73% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
2:39.137Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
2:41.747Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_vers
2:43.676Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_vers
2:44.680Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, spiderling, egg_sac, flask_of_alchemical_chaos_vers
2:47.337Ebackstab
[build]
Fluffy_Pillow 44.4/100 44% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_vers
2:50.241Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_vers
2:51.246Ebackstab
[build]
Fluffy_Pillow 46.5/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_vers
2:53.977Ebackstab
[build]
Fluffy_Pillow 45.1/100 45% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_vers
2:56.870Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_vers
2:59.495Neviscerate
[finish]
Fluffy_Pillow 38.9/100 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), stormbringers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_vers
3:00.500Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_vers
3:00.500Ebackstab
[build]
Fluffy_Pillow 50.2/100 50% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:02.463Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:03.466Jflagellation
[cds]
Fluffy_Pillow 11.4/100 11% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:04.470Hsymbols_of_death
[cds]
Combo 2 22.7/100 23% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, flagellation_buff, deeper_daggers, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:04.470Qshadow_dance
[stealth_cds]
Combo 2 62.7/100 63% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:04.470Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 62.7/100 63% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, realigning_nexus_convergence_divergence, egg_sac(3), flask_of_alchemical_chaos_vers
3:04.470Ksecret_technique
[finish]
Fluffy_Pillow 62.7/100 63% energy
6.0/7 86% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_vers
3:05.472Dshadowstrike
[build]
Fluffy_Pillow 96.9/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(10), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_vers
3:06.477Ishadow_blades
[cds]
Combo 2 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_vers
3:06.477Neviscerate
[finish]
Fluffy_Pillow 62.9/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, flagellation_buff(10), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_vers
3:07.481Dshadowstrike
[build]
Fluffy_Pillow 96.9/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_vers
3:08.485Mcoup_de_grace
[finish]
Fluffy_Pillow 70.9/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(20), deeper_daggers, bolstering_shadows, ethereal_powerlink, spiderling, egg_sac(2), flask_of_alchemical_chaos_vers
3:09.690Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:10.695Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:11.699Neviscerate
[finish]
Fluffy_Pillow 85.1/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:12.703Ebackstab
[build]
Fluffy_Pillow 96.1/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:13.707Lrupture
[finish]
Fluffy_Pillow 67.1/100 67% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:14.710Hsymbols_of_death
[cds]
Combo 2 96.1/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:14.710Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:14.710Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:15.717Fcold_blood
[cds]
Combo 2 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:15.717Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:16.721Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:17.727Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:18.732Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_mastery
3:19.735Dshadowstrike
[build]
Fluffy_Pillow 85.0/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:20.740Neviscerate
[finish]
Fluffy_Pillow 59.1/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:21.743Dshadowstrike
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:22.747Neviscerate
[finish]
Fluffy_Pillow 44.1/100 44% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:23.753Neviscerate
[finish]
Fluffy_Pillow 63.2/100 63% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:24.758Ebackstab
[build]
Fluffy_Pillow 74.2/100 74% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_persist(30), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:25.761Ebackstab
[build]
Fluffy_Pillow 53.2/100 53% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:26.766Hsymbols_of_death
[cds]
Combo 2 32.3/100 32% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:26.766Qshadow_dance
[stealth_cds]
Combo 2 72.3/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:26.766Neviscerate
[finish]
Fluffy_Pillow 72.3/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(2), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:27.769Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(4), the_rotten(2), deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:28.772Ksecret_technique
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:29.775Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:30.778Mcoup_de_grace
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:31.983Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:32.987Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:33.991Dshadowstrike
[build]
Fluffy_Pillow 85.0/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:34.995Neviscerate
[finish]
Fluffy_Pillow 59.1/100 59% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, egg_sac(2), flask_of_alchemical_chaos_mastery
3:35.999Ebackstab
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:37.002Ebackstab
[build]
Fluffy_Pillow 57.1/100 57% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:38.006Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:39.011Ebackstab
[build]
Fluffy_Pillow 47.2/100 47% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_mastery
3:41.374Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit
3:42.920Lrupture
[finish]
Fluffy_Pillow 34.3/100 34% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit
3:43.924Ebackstab
[build]
Fluffy_Pillow 55.3/100 55% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit
3:45.806Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
3:48.724Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, egg_sac(3), flask_of_alchemical_chaos_crit
3:49.729Ebackstab
[build]
Fluffy_Pillow 47.4/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
3:50.734Hsymbols_of_death
[cds]
Combo 2 22.4/100 22% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
3:50.734Ebackstab
[build]
Fluffy_Pillow 62.4/100 62% energy
2.0/7 29% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
3:51.738Qshadow_dance
[stealth_cds]
Combo 2 33.5/100 34% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), the_rotten, deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
3:51.738Ksecret_technique
[finish]
Fluffy_Pillow 33.5/100 34% energy
4.0/7 57% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, the_rotten, deeper_daggers, poised_shadows, egg_sac(3), flask_of_alchemical_chaos_crit
3:52.743Dshadowstrike
[build]
Fluffy_Pillow 57.6/100 58% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
3:54.875Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
3:55.878Dshadowstrike
[build]
Fluffy_Pillow 70.2/100 70% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
3:56.882Mcoup_de_grace
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
3:58.085Dshadowstrike
[build]
Fluffy_Pillow 90.5/100 91% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
3:59.090Neviscerate
[finish]
Fluffy_Pillow 64.6/100 65% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:00.094Ebackstab
[build]
Fluffy_Pillow 83.7/100 84% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:01.097Ebackstab
[build]
Fluffy_Pillow 62.7/100 63% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:02.102Neviscerate
[finish]
Fluffy_Pillow 41.8/100 42% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:03.107Ebackstab
[build]
Fluffy_Pillow 60.9/100 61% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(5), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:04.424Neviscerate
[finish]
Fluffy_Pillow 35.4/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, seabed_leviathans_citrine_proc, egg_sac, flask_of_alchemical_chaos_crit
4:05.429Rvanish
[stealth_cds]
Combo 2 45.5/100 45% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
4:05.429Dshadowstrike
[build]
Fluffy_Pillow 45.5/100 45% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), premeditation, shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
4:07.863Ksecret_technique
[finish]
Fluffy_Pillow 35.3/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, egg_sac(2), flask_of_alchemical_chaos_crit
4:08.867Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
4:10.914Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_crit
4:12.667Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:13.669Ebackstab
[build]
Fluffy_Pillow 51.4/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:15.913Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:19.190Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:21.601Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:22.804Ebackstab
[build]
Fluffy_Pillow 78.8/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:23.808Ebackstab
[build]
Fluffy_Pillow 53.8/100 54% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:25.536Neviscerate
[finish]
Fluffy_Pillow 36.8/100 37% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, egg_sac(3), flask_of_alchemical_chaos_crit
4:26.542Ebackstab
[build]
Fluffy_Pillow 42.9/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
4:29.312Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
4:31.523Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 33.5/100 34% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_crit
4:32.192Ebackstab
[build]
Fluffy_Pillow 40.9/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), deeper_daggers, cryptic_instructions, egg_sac(3), flask_of_alchemical_chaos_crit
4:33.565Jflagellation
[cds]
Fluffy_Pillow 20.0/100 20% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), cryptic_instructions, egg_sac(3), flask_of_alchemical_chaos_crit
4:34.569Hsymbols_of_death
[cds]
Combo 2 35.0/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(3), flagellation_buff, cryptic_instructions, egg_sac(3), flask_of_alchemical_chaos_crit
4:34.569Qshadow_dance
[stealth_cds]
Combo 2 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, shadow_techniques(3), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, egg_sac(3), flask_of_alchemical_chaos_crit
4:34.569Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff, poised_shadows, cryptic_instructions, egg_sac(3), flask_of_alchemical_chaos_crit
4:34.569Neviscerate
[finish]
Fluffy_Pillow 75.0/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff, poised_shadows, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:35.574Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(5), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:36.580Ishadow_blades
[cds]
Combo 2 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:36.580Ksecret_technique
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:37.585Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(2), the_rotten, flagellation_buff(21), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:38.590Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(2), shadow_techniques(4), the_rotten, flagellation_buff(28), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_crit
4:39.593Neviscerate
[finish]
Fluffy_Pillow 74.2/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_buff(28), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:40.596Dshadowstrike
[build]
Fluffy_Pillow 85.8/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:41.600Neviscerate
[finish]
Fluffy_Pillow 60.7/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:42.604Neviscerate
[finish]
Fluffy_Pillow 72.6/100 73% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, flagellation_buff(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:43.607Ebackstab
[build]
Fluffy_Pillow 92.4/100 92% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:44.611Lrupture
[finish]
Fluffy_Pillow 64.3/100 64% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(3), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(3), flask_of_alchemical_chaos_haste
4:45.616Hsymbols_of_death
[cds]
Combo 2 94.2/100 94% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(5), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:45.616Qshadow_dance
[stealth_cds]
Combo 2 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:45.616Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:46.621Mcoup_de_grace
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(5), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:47.824Fcold_blood
[cds]
Combo 2 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(10), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:47.824Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(10), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:48.829Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, ethereal_powerlink, egg_sac(2), flask_of_alchemical_chaos_haste
4:49.833Neviscerate
[finish]
Fluffy_Pillow 74.9/100 75% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(11), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:50.838Dshadowstrike
[build]
Fluffy_Pillow 86.8/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:51.842Neviscerate
[finish]
Fluffy_Pillow 61.6/100 62% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(11), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:52.846Dshadowstrike
[build]
Fluffy_Pillow 81.5/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:53.850Neviscerate
[finish]
Fluffy_Pillow 48.4/100 48% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:54.853Ebackstab
[build]
Fluffy_Pillow 60.2/100 60% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(11), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, egg_sac(2), flask_of_alchemical_chaos_haste
4:56.032Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(11), shadow_techniques(2), flagellation_persist(30), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_haste
4:58.460Mcoup_de_grace
[finish]
Fluffy_Pillow 38.2/100 38% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(10), shadow_techniques(3), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_haste
4:59.665Ebackstab
[build]
Fluffy_Pillow 85.2/100 85% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(10), shadow_techniques(5), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_haste
5:00.670Neviscerate
[finish]
Fluffy_Pillow 56.8/100 57% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), deeper_daggers, egg_sac(3), flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470539685273232574 (26976)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste4.58%5.03%3317
Versatility25.21%22.21%17321
Attack Power5765153670938
Mastery78.39%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Ara-Kara Sacbrood
ilevel: 639, stats: { +1,445 Haste }
item effects: { equip: Ara-Kara Sacbrood }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 2"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=arakara_sacbrood,id=219314,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=32574
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=3252
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Combo 3 : 1,486,514 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,486,513.91,486,513.92,896.9 / 0.195%188,228.9 / 12.7%49,832.7
Resource Out In Waiting APM Active
Energy29.829.611.79%57.0100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Combo 31,486,514
Auto Attack 0 (70,448)0.0% (4.7%)3.9122.49s5,344,3880

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 47,0163.2%355.60.98s39,46240,616Direct355.638,38877,54139,46018.8%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.63355.630.000.000.000.97160.000014,033,707.7818,310,065.6823.36%40,615.8440,615.84
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.77%230.3416930138,388.1322,77363,49338,404.4336,61540,6838,842,19311,537,62123.36%
crit18.83%66.963610077,540.6346,071127,09377,578.9971,01087,3115,191,5156,772,44523.34%
miss16.40%58.3332860.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,4331.6%355.50.98s19,67420,222Direct355.519,13138,61519,67818.9%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage355.48355.480.000.000.000.97290.00006,993,627.619,124,595.4223.35%20,222.2620,222.26
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.63%229.7416030619,130.6411,33031,59619,138.1618,12719,9894,394,9825,734,61223.36%
crit18.93%67.303411138,615.4722,99063,32938,636.3734,69443,4162,598,6463,389,98323.34%
miss16.44%58.4331890.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 29,9702.0%74.73.69s120,092119,556Direct74.772,678188,870120,09940.8%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.6674.660.000.000.001.00450.00008,966,070.1911,731,844.4223.57%119,555.57119,555.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit59.20%44.20256572,677.9857,139141,74572,675.6868,35276,5813,212,1534,205,39423.60%
crit40.80%30.461550188,869.76125,912400,230188,938.49173,951213,8095,753,9187,526,45023.57%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:74.66

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 88,857 (126,686)6.0% (8.5%)13.322.30s2,852,5622,368,303Direct39.7 (77.8)516,9831,037,766668,07929.0% (28.8%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2539.680.000.000.001.20450.000026,513,027.0434,518,839.4723.19%2,368,302.912,368,302.91
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.99%28.171442516,982.61118,5321,893,796517,129.84341,821724,88614,564,18518,962,49923.20%
crit29.01%11.513231,037,765.56239,8463,620,2911,037,672.02374,0292,018,63711,948,84215,556,34123.20%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.25
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 37,8292.5%0.00.00s00Direct38.2229,815459,754295,78928.7%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.170.000.000.000.00000.000011,289,824.0111,289,824.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.33%27.221341229,815.0454,368821,596230,336.41140,320339,3786,257,4926,257,4920.00%
crit28.67%10.94125459,753.78114,3451,536,669461,211.60209,585792,8245,032,3325,032,3320.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (19,967)0.0% (1.3%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 19,9671.3%22.212.91s268,6630Direct22.2268,7690268,7690.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.2122.200.000.000.000.00000.00005,966,062.935,966,062.930.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.201139268,768.88260,578310,782268,722.70262,617277,3555,966,0635,966,0630.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 253,227 (362,056)17.0% (24.3%)68.44.37s1,579,5981,572,522Direct68.4 (135.4)848,7131,746,4231,105,09728.6% (28.5%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.3768.370.000.000.001.00450.000075,539,022.1398,262,493.0723.13%1,572,521.661,572,521.66
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.45%48.853267848,713.03210,8622,425,542848,348.62708,8941,056,47241,445,90553,917,71523.13%
crit28.55%19.528331,746,423.44422,3574,756,5891,749,064.891,049,4852,491,55634,093,11744,344,77823.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.38

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 108,8307.3%67.14.45s484,0840Direct67.1374,158761,117484,33328.5%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.0667.060.000.000.000.00000.000032,464,910.3732,464,910.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.55%47.983275374,158.11100,5271,052,287374,220.89301,747448,24517,949,87317,949,8730.00%
crit28.45%19.08733761,116.93201,3562,062,411760,249.65495,7761,086,26714,515,03714,515,0370.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,014 (21,177)0.1% (1.4%)3.791.43s1,715,6041,708,104Direct3.7 (27.8)69,470138,80582,03818.1% (19.2%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.693.690.000.000.001.00450.0000302,305.66302,305.660.00%1,708,104.081,708,104.08
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.93%3.020469,469.5460,925139,09769,253.47089,644209,804209,8040.00%
crit18.07%0.6704138,805.21122,033258,37670,969.100258,37692,50192,5010.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.69
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,1631.4%0.00.00s00Direct24.1209,450418,845250,04119.4%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0024.080.000.000.000.00000.00006,021,095.646,021,095.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.62%19.41927209,449.5673,719439,144209,338.93168,728257,1564,066,9044,066,9040.00%
crit19.38%4.67013418,844.82155,512842,798416,145.450770,5001,954,1921,954,1920.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,2030.8%0.00.00s00Direct283.710,77921,70112,84118.9%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00283.680.000.000.000.00000.00003,642,582.833,642,582.830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.12%230.1316030510,779.217,51417,33110,781.9010,19111,3042,480,6922,480,6920.00%
crit18.88%53.55279321,701.4815,05134,64221,703.7119,10324,0661,161,8911,161,8910.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Phantom Reaping 20,433 (23,805)1.4% (1.6%)19.114.97s371,7190Direct19.1 (31.9)267,872536,807318,96819.0% (19.0%)0.0%

Stats Details: Phantom Reaping

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.1319.130.000.000.000.00000.00006,102,079.396,102,079.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.97%15.49532267,872.36259,030309,139267,828.63260,452278,8074,148,5844,148,5840.00%
crit19.03%3.64012536,807.17518,836619,206526,106.430593,4341,953,4951,953,4950.00%

Action Details: Phantom Reaping

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:201465.44
  • base_dd_max:201465.44
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
    Phantom Reaping (Echo) 3,3720.2%12.86.25s78,7270Direct12.866,092132,38378,69619.1%0.0%

Stats Details: Phantom Reaping Echo

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.8012.800.000.000.000.00000.00001,007,621.951,007,621.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.94%10.3622466,091.7064,75773,45266,064.9264,75769,379684,729684,7290.00%
crit19.06%2.44010132,383.03129,708145,368118,339.180142,792322,893322,8930.00%

Action Details: Phantom Reaping Echo

  • id:448669
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50366.36
  • base_dd_max:50366.36
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448669
  • name:Phantom Reaping
  • school:shadow
  • tooltip:
  • description:{$@spelldesc444067=Your abilities have a high chance to summon a phantom ethereal, dealing {$=}{{$=}<rolemult>*{$s1=67342}} Shadow damage to your target and {$=}{{$=}<rolemult>*{$s1=67342}*({$s5=9}/100)} Shadow damage to all other enemies caught in its path. If the target is below {$s2=35}% health, this effect summons two additional phantoms at {$s3=25}% effectiveness.}
Rupture 99,043 (117,242)6.7% (7.9%)9.531.43s3,686,6853,670,490Periodic167.2 (334.4)135,982282,975176,77627.8% (27.8%)0.0%97.0%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.490.00167.21167.217.031.00451.733629,556,322.6829,556,322.680.00%116,853.503,670,489.53
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.23%120.7887163135,981.5389425,897136,095.80117,869153,73616,425,14416,425,1440.00%
crit27.77%46.432572282,974.80256864,899283,328.61215,821377,95813,131,17913,131,1790.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.49
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1991.2%167.21.76s32,4790Periodic167.225,00151,91732,48027.8%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.210.000.00167.210.000.00000.00005,430,783.495,430,783.490.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.20%120.738516125,001.449,67179,17625,016.9922,13427,7363,017,9753,017,9750.00%
crit27.80%46.48247251,917.3919,371155,01151,975.1139,15464,7152,412,8092,412,8090.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (270,952)0.0% (18.2%)16.018.88s5,057,7255,035,339

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.980.000.000.000.001.00450.00000.000.000.00%5,035,339.215,035,339.21

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.98
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,3384.7%0.00.00s00Direct16.0678,5412,130,4591,294,97142.5%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.980.000.000.000.00000.000020,688,529.8126,967,582.5623.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.54%9.20414678,541.04151,5591,517,727679,135.47443,072944,3796,237,4578,154,14023.51%
crit42.46%6.793132,130,458.59302,5984,137,4752,170,411.881,411,7883,214,16814,451,07318,813,44223.18%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 201,61413.6%0.00.00s00Direct31.9984,7593,042,8561,888,52143.9%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.870.000.000.000.00000.000060,148,805.9460,148,805.940.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.11%17.88828984,758.77222,2922,256,887986,818.58738,2911,328,63117,611,76317,611,7630.00%
crit43.89%13.996243,042,855.95461,3865,983,2813,067,524.302,169,9204,401,69242,537,04342,537,0430.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (105,294)0.0% (7.1%)3.690.91s8,680,5800

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.620.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.63
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 105,2947.1%393.11.16s79,9740Periodic393.179,976079,9760.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage393.150.000.00393.150.000.00000.000031,441,776.5931,441,776.590.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%393.1530047479,975.54201,078,79580,013.6266,77994,60931,441,77731,441,7770.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3677.46
  • base_dd_max:3677.46
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 116,7687.8%52.05.80s668,693665,709Direct52.0279,558912,712668,82161.5%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.0452.040.000.000.001.00450.000034,797,271.4445,373,733.5323.31%665,708.93665,708.93
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.52%20.041130279,558.20130,261406,711279,585.19254,211308,4965,604,4977,301,58623.25%
crit61.48%31.992244912,711.89287,0431,395,375913,144.61833,209979,14229,192,77438,072,14723.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.02

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7230.3%2.475.12s471,8490Direct2.4398,085797,906472,19318.5%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.362.360.000.000.000.00000.00001,111,852.491,111,852.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.52%1.9208398,084.54377,346493,247344,005.650472,864764,441764,4410.00%
crit18.48%0.4406797,906.42755,824940,849275,650.770940,849347,412347,4120.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8430.1%2.366.56s108,6100Direct2.390,659182,602108,59619.5%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.0000251,636.12251,636.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.47%1.860890,658.8583,958119,92875,945.380119,393169,018169,0180.00%
crit19.53%0.4505182,601.85168,168240,72065,649.140240,72082,61882,6180.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71132.29
  • base_dd_max:71132.29
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,3193.2%19.114.65s740,8720Periodic107.1132,0020132,0020.0%0.0%71.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.080.00107.09107.0912.140.00002.000014,133,760.5014,133,760.500.00%65,988.870.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.0965161132,002.2060,995218,499131,056.3274,921183,25714,133,76014,133,7600.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 68,7844.6%34.98.49s589,3590Direct34.9494,940993,792589,34018.9%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage34.8834.880.000.000.000.00000.000020,559,304.2220,559,304.220.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.06%28.281350494,940.09453,001862,119494,672.49464,742538,16413,994,73213,994,7320.00%
crit18.94%6.61017993,791.84907,3601,705,562991,088.2801,365,1646,564,5726,564,5720.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,3240.3%2.365.68s567,9570Direct2.3478,207959,094568,24418.6%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.272.270.000.000.000.00000.00001,288,354.121,288,354.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.36%1.8507478,207.40452,539575,807402,323.860544,944882,792882,7920.00%
crit18.64%0.4204959,094.38906,4361,112,969327,814.1201,107,313405,562405,5620.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 84,9515.7%58.05.13s437,3250Direct58.0367,664741,265437,45918.7%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.9657.960.000.000.000.00000.000025,348,377.2733,113,714.6823.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.34%47.152966367,663.98220,828559,714367,782.34338,765398,62617,330,81722,641,79523.46%
crit18.66%10.82322741,264.58442,3191,118,782742,236.82550,672929,2358,017,56010,471,91923.44%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Combo 3
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.590.92s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.550.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.55
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.792.05s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.710.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.511.08s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.540.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.368.25s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.474.50s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.360.0069.230.000.360.00000.83470.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5308.54s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.460.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.45
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.43.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.279.09s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.223.18s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.230.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.23
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.366.56s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.322.320.000.000.000.00000.00000.001,578,818.920.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.32090.00000.000001,578,81990.31%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8430.1%2.366.56s108,6100Direct2.390,659182,602108,59619.5%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.0000251,636.12251,636.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.47%1.860890,658.8583,958119,92875,945.380119,393169,018169,0180.00%
crit19.53%0.4505182,601.85168,168240,72065,649.140240,72082,61882,6180.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:71132.29
  • base_dd_max:71132.29
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.221.28s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.24
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.49s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Combo 3
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.94
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.366.02s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1593.2157.2s0.5s274.1s99.95%100.00%583.4 (583.4)0.1

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:24.5s / 341.4s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:4.0s / 359.9s
  • uptime_min/max:99.30% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.20%
  • acrobatic_strikes_2:0.20%
  • acrobatic_strikes_3:0.18%
  • acrobatic_strikes_4:0.16%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.14%
  • acrobatic_strikes_7:0.13%
  • acrobatic_strikes_8:0.13%
  • acrobatic_strikes_9:0.13%
  • acrobatic_strikes_10:98.53%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.2117.3s3.5s125.2s97.23%0.00%73.7 (76.5)1.3

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 352.0s
  • trigger_min/max:1.0s / 43.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 357.7s
  • uptime_min/max:85.96% / 99.44%

Stack Uptimes

  • alacrity_1:3.07%
  • alacrity_2:2.20%
  • alacrity_3:1.83%
  • alacrity_4:1.67%
  • alacrity_5:88.45%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.57%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.07%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 56.2s
  • trigger_min/max:9.2s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:32.53% / 41.67%

Stack Uptimes

  • bolstering_shadows_1:37.07%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.50.090.8s90.8s0.2s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:84.2s / 104.0s
  • trigger_min/max:84.2s / 104.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.2s
  • uptime_min/max:0.00% / 0.08%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.20.0128.1s110.8s4.4s1.76%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 281.1s
  • trigger_min/max:90.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 14.5s
  • uptime_min/max:0.00% / 7.49%

Stack Uptimes

  • cryptic_instructions_1:1.77%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.247.723.2s23.2s8.2s36.41%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 71.8s
  • trigger_min/max:8.0s / 71.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.69% / 38.88%

Stack Uptimes

  • danse_macabre_1:0.03%
  • danse_macabre_2:4.54%
  • danse_macabre_3:6.60%
  • danse_macabre_4:16.52%
  • danse_macabre_5:8.70%
  • danse_macabre_6:0.02%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.040.6s3.7s35.3s90.03%95.74%74.0 (74.0)6.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.6s
  • trigger_min/max:1.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 162.4s
  • uptime_min/max:80.41% / 96.05%

Stack Uptimes

  • deeper_daggers_1:90.03%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.46%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 56.2s
  • trigger_min/max:9.2s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.17% / 22.04%

Stack Uptimes

  • disorienting_strikes_1:12.25%
  • disorienting_strikes_2:6.21%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.30.0130.1s106.0s4.0s1.72%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 298.6s
  • trigger_min/max:90.0s / 190.5s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 11.6s
  • uptime_min/max:0.00% / 6.84%

Stack Uptimes

  • errant_manaforge_emission_1:1.72%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.143.922.0s5.2s17.3s81.32%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 60.9s
  • trigger_min/max:1.0s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.4s
  • uptime_min/max:68.07% / 93.63%

Stack Uptimes

  • escalating_blade_1:24.83%
  • escalating_blade_2:22.12%
  • escalating_blade_3:22.51%
  • escalating_blade_4:11.87%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.6s90.6s14.7s18.16%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.6s / 181.6s
  • trigger_min/max:83.6s / 181.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s
  • uptime_min/max:12.70% / 20.78%

Stack Uptimes

  • ethereal_powerlink_1:18.16%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.285.8s73.3s15.4s10.89%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4643.24

Trigger Details

  • interval_min/max:15.1s / 303.0s
  • trigger_min/max:0.9s / 303.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 46.9s
  • uptime_min/max:0.00% / 34.36%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.89%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.724.291.3s9.5s11.8s14.60%0.00%14.6 (98.8)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.0s
  • trigger_min/max:1.0s / 87.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.90% / 16.92%

Stack Uptimes

  • flagellation_buff_1:1.32%
  • flagellation_buff_7:0.03%
  • flagellation_buff_8:0.76%
  • flagellation_buff_9:0.62%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.47%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.03%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.70%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.43%
  • flagellation_buff_20:0.38%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.20%
  • flagellation_buff_25:0.76%
  • flagellation_buff_26:0.38%
  • flagellation_buff_27:0.18%
  • flagellation_buff_28:0.21%
  • flagellation_buff_29:0.00%
  • flagellation_buff_30:7.16%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.1s91.1s11.8s14.20%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.2s / 98.0s
  • trigger_min/max:78.2s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s
  • uptime_min/max:12.47% / 16.25%

Stack Uptimes

  • flagellation_persist_1:0.00%
  • flagellation_persist_13:0.00%
  • flagellation_persist_23:0.00%
  • flagellation_persist_26:0.01%
  • flagellation_persist_30:14.19%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.9s77.1s35.5s25.07%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 340.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 180.0s
  • uptime_min/max:0.00% / 72.56%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.07%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6113.3s79.6s34.8s25.03%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.0s
  • uptime_min/max:0.00% / 74.57%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.03%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6113.2s77.5s35.0s24.80%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.6s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 178.5s
  • uptime_min/max:0.00% / 89.85%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.80%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.8s77.6s35.4s25.11%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 328.2s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 74.70%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.11%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.20.039.4s3.4s58.7s95.24%100.00%0.0 (0.0)3.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.71%
  • flawless_form_2:8.80%
  • flawless_form_3:11.63%
  • flawless_form_4:9.57%
  • flawless_form_5:2.82%
  • flawless_form_6:4.37%
  • flawless_form_7:5.95%
  • flawless_form_8:11.12%
  • flawless_form_9:18.25%
  • flawless_form_10:9.07%
  • flawless_form_11:1.58%
  • flawless_form_12:0.08%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.19%
  • flawless_form_16:0.10%
  • flawless_form_17:0.02%
  • flawless_form_18:0.01%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Poised Shadows13.80.422.0s21.3s3.6s16.73%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 84.5s
  • trigger_min/max:1.0s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.9s
  • uptime_min/max:9.07% / 25.33%

Stack Uptimes

  • poised_shadows_1:16.73%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion1.00.00.0s0.0s15.0s5.09%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s
  • uptime_min/max:4.17% / 6.25%

Stack Uptimes

  • power_infusion_1:5.09%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=15 seconds}, increasing haste by {$s1=20}%. Can only be cast on players.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Premeditation17.20.017.9s18.9s1.1s2.67%11.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 69.2s
  • trigger_min/max:1.0s / 69.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.2s
  • uptime_min/max:0.90% / 4.64%

Stack Uptimes

  • premeditation_1:2.67%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0130.1s110.6s4.0s1.64%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 278.9s
  • trigger_min/max:90.0s / 186.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 14.5s
  • uptime_min/max:0.00% / 6.49%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.64%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.283.0s70.6s15.4s10.71%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23996.43

Trigger Details

  • interval_min/max:15.1s / 299.2s
  • trigger_min/max:1.0s / 299.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.1s
  • uptime_min/max:0.00% / 33.71%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.71%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.9s90.9s15.8s19.16%16.87%0.0 (0.0)3.5

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 102.6s
  • trigger_min/max:90.0s / 102.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.72% / 21.83%

Stack Uptimes

  • shadow_blades_1:19.16%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.20.023.2s23.2s8.2s36.41%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 71.8s
  • trigger_min/max:8.0s / 71.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.69% / 38.88%

Stack Uptimes

  • shadow_dance_1:36.41%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques68.1139.24.4s1.4s3.5s79.13%95.39%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 52.4s
  • trigger_min/max:0.5s / 6.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.4s
  • uptime_min/max:71.53% / 86.53%

Stack Uptimes

  • shadow_techniques_1:20.43%
  • shadow_techniques_2:20.87%
  • shadow_techniques_3:9.45%
  • shadow_techniques_4:10.43%
  • shadow_techniques_5:6.01%
  • shadow_techniques_6:5.82%
  • shadow_techniques_7:2.55%
  • shadow_techniques_8:2.38%
  • shadow_techniques_9:0.55%
  • shadow_techniques_10:0.53%
  • shadow_techniques_11:0.05%
  • shadow_techniques_12:0.04%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.01%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s296.8s99.32%86.59%98.4 (98.4)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.40.098.5s90.1s9.9s1.46%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:3.0s / 277.5s
  • trigger_min/max:1.0s / 243.3s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 18.4s
  • uptime_min/max:0.00% / 12.35%

Stack Uptimes

  • storm_sewers_citrine_1:1.46%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0113.6s105.8s9.9s1.36%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.3s / 282.7s
  • trigger_min/max:3.4s / 254.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 13.9s
  • uptime_min/max:0.00% / 10.88%

Stack Uptimes

  • storm_sewers_citrine_1:1.36%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0114.7s102.7s10.0s1.53%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.2s / 311.9s
  • trigger_min/max:1.0s / 311.9s
  • trigger_pct:100.00%
  • duration_min/max:3.1s / 18.2s
  • uptime_min/max:0.00% / 14.17%

Stack Uptimes

  • storm_sewers_citrine_1:1.53%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0104.7s94.5s10.0s1.63%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:2.0s / 294.8s
  • trigger_min/max:2.2s / 294.8s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 19.2s
  • uptime_min/max:0.00% / 13.54%

Stack Uptimes

  • storm_sewers_citrine_1:1.63%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.282.8s71.3s15.4s10.93%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1374.86
  • stat:haste_rating
  • amount:1374.86
  • stat:mastery_rating
  • amount:1374.86
  • stat:versatility_rating
  • amount:1374.86

Trigger Details

  • interval_min/max:15.1s / 307.7s
  • trigger_min/max:1.0s / 307.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 45.3s
  • uptime_min/max:0.00% / 37.09%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.93%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s10.84%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.2s / 63.4s
  • trigger_min/max:3.2s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:8.66% / 14.83%

Stack Uptimes

  • supercharge_1_1:10.84%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.09%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 63.4s
  • trigger_min/max:1.0s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.9s
  • uptime_min/max:0.41% / 6.24%

Stack Uptimes

  • supercharge_2_1:2.09%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s2.3s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 6.9s
  • uptime_min/max:0.00% / 2.41%

Stack Uptimes

  • supercharge_3_1:0.01%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s5.7s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.7s / 5.7s
  • uptime_min/max:0.00% / 1.99%

Stack Uptimes

  • supercharge_4_1:0.01%

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.843.6s21.3s24.6s61.11%100.00%6.8 (6.8)6.8

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.3s / 97.3s
  • trigger_min/max:1.0s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s
  • uptime_min/max:58.00% / 65.06%

Stack Uptimes

  • symbols_of_death_1:61.11%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0308.0s308.0s27.8s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.2s
  • trigger_min/max:300.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.95% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.95%22.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 63.4s
  • trigger_min/max:1.0s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.2s
  • uptime_min/max:11.53% / 17.13%

Stack Uptimes

  • the_rotten_1:10.79%
  • the_rotten_2:3.15%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.3s122.3s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.7s
  • trigger_min/max:120.0s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.44%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.00.019.3s11.6s15.1s0.22%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4609.71

Trigger Details

  • interval_min/max:19.3s / 19.3s
  • trigger_min/max:1.0s / 19.3s
  • trigger_pct:100.00%
  • duration_min/max:4.2s / 28.1s
  • uptime_min/max:0.00% / 10.88%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.28%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.283.0s71.2s15.3s10.58%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5516.42

Trigger Details

  • interval_min/max:15.1s / 328.0s
  • trigger_min/max:0.9s / 328.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.1s
  • uptime_min/max:0.00% / 33.02%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.58%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)49.626.076.06.0s0.6s58.4s
Skyfury (Off Hand)49.925.076.05.9s0.6s68.7s
Supercharger secret_technique12.58.017.023.3s9.2s92.1s
Cold Blood secret_technique3.53.04.090.8s84.2s104.0s
Supercharger rupture0.30.03.0188.6s47.8s289.4s
Supercharger coup_de_grace2.90.08.077.6s9.2s318.0s
Supercharger eviscerate12.76.020.023.6s1.0s186.3s
CP Spent During Flagellation204.0145.0250.011.0s1.0s95.7s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.74%6.67%13.28%0.7s0.0s2.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Combo 3
Energy RegenEnergy1,452.393,018.2534.11%2.08429.7612.46%
Improved AmbushCombo Points52.0233.614.61%0.6518.4235.40%
PremeditationCombo Points17.1556.947.81%3.3263.0852.56%
Relentless StrikesEnergy107.114,246.0447.99%39.64138.393.16%
Shadow BladesCombo Points21.40111.1715.24%5.1917.2513.43%
Shadow TechniquesEnergy361.371,227.1913.87%3.40218.3015.10%
Shadow TechniquesCombo Points85.05239.0532.78%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.74110.2015.11%7.000.000.00%
BackstabCombo Points74.6674.3310.19%1.000.330.44%
ShadowstrikeCombo Points52.02104.0114.26%2.000.040.04%
Symbols of DeathEnergy14.23356.634.03%25.06212.7237.36%
Usage Type Count Total Tot% Avg RPE APR
Combo 3
BackstabEnergy74.662,986.5433.55%40.0040.003,002.16
Coup de GraceEnergy13.25463.805.21%35.0035.0081,507.39
Coup de GraceCombo Points13.2590.4412.47%6.836.82417,965.36
EviscerateEnergy68.382,393.4326.89%35.0035.0045,125.21
EviscerateCombo Points68.38465.8264.20%6.816.81231,855.59
RuptureEnergy9.49237.282.67%25.0025.00147,451.98
RuptureCombo Points9.4964.858.94%6.836.83539,494.15
Secret TechniqueEnergy15.98479.445.39%30.0030.00168,607.65
Secret TechniqueCombo Points15.98104.4414.39%6.546.53773,990.58
ShadowstrikeEnergy52.022,341.1226.30%45.0044.9914,863.52
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6229.79998.846.60.8100.0
Combo Points0.02.442.4399.13.70.07.0

Statistics & Data Analysis

Fight Length
Combo 3 Fight Length
Count 1114
Mean 298.78
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Combo 3 Damage Per Second
Count 1114
Mean 1486513.93
Minimum 1358708.50
Maximum 1676873.82
Spread ( max - min ) 318165.32
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 49331.4179
5th Percentile 1406794.89
95th Percentile 1568346.18
( 95th Percentile - 5th Percentile ) 161551.30
Mean Distribution
Standard Deviation 1478.0224
95.00% Confidence Interval ( 1483617.06 - 1489410.80 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4231
0.1 Scale Factor Error with Delta=300 20774514
0.05 Scale Factor Error with Delta=300 83098055
0.01 Scale Factor Error with Delta=300 2077451368
Priority Target DPS
Combo 3 Priority Target Damage Per Second
Count 1114
Mean 1486513.93
Minimum 1358708.50
Maximum 1676873.82
Spread ( max - min ) 318165.32
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 49331.4179
5th Percentile 1406794.89
95th Percentile 1568346.18
( 95th Percentile - 5th Percentile ) 161551.30
Mean Distribution
Standard Deviation 1478.0224
95.00% Confidence Interval ( 1483617.06 - 1489410.80 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4231
0.1 Scale Factor Error with Delta=300 20774514
0.05 Scale Factor Error with Delta=300 83098055
0.01 Scale Factor Error with Delta=300 2077451368
DPS(e)
Combo 3 Damage Per Second (Effective)
Count 1114
Mean 1486513.93
Minimum 1358708.50
Maximum 1676873.82
Spread ( max - min ) 318165.32
Range [ ( max - min ) / 2 * 100% ] 10.70%
Damage
Combo 3 Damage
Count 1114
Mean 443598712.20
Minimum 345521288.14
Maximum 541369837.08
Spread ( max - min ) 195848548.94
Range [ ( max - min ) / 2 * 100% ] 22.07%
DTPS
Combo 3 Damage Taken Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Combo 3 Healing Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Combo 3 Healing Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Combo 3 Heal
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Combo 3 Healing Taken Per Second
Count 1114
Mean 3024.56
Minimum 0.00
Maximum 10089.37
Spread ( max - min ) 10089.37
Range [ ( max - min ) / 2 * 100% ] 166.79%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.02 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 74.66 backstab
actions.cds
# count action,conditions
F 3.55 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.45 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.24 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.63 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.69 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.98 secret_technique,if=variable.secret
L 9.49 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.25 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.38 eviscerate
actions.item
# count action,conditions
O 3.71 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.68 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.23 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.94 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

025ODGJNRDLHQPDIKDNNDMNDHNFKDNNENNEENEEHQNDKNDDMDLENEENHQDNKDNDDNENEEMHQDNKDNDDNELEENENEEEMEENEOEJHQPKDNDINDNDLNEQNDFHKNDMDNNEENEENENERELEHQKDNDMDDNENEENEEEKEELEEEMEEENEOEJHQPNDKDINDNNELEHQMNDFKNDNDNENEENHQDNKDDMDNEEELENEEHQNDKDNDMDNEENERENEELEEENEENEOEJHQPKDMIDNNDNNHELQDFKNDNDMNENEENEE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Gpotion
[cds]
Fluffy_Pillow 71.0/100 71% energy
7.0/7 100% CP
bloodlust, power_infusion, acrobatic_strikes(2), flawless_form, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Jflagellation
[cds]
Fluffy_Pillow 71.0/100 71% energy
7.0/7 100% CP
bloodlust, power_infusion, acrobatic_strikes(2), flawless_form, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.007Neviscerate
[finish]
Fluffy_Pillow 91.7/100 92% energy
7.0/7 100% CP
bloodlust, power_infusion, acrobatic_strikes(5), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.011Rvanish
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, acrobatic_strikes(7), flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.011Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, vanish, acrobatic_strikes(7), flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.015Lrupture
[finish]
Fluffy_Pillow 75.7/100 76% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, acrobatic_strikes(10), flawless_form(2), shadow_techniques(3), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.020Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form(2), shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.020Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.020Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.020Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.026Ishadow_blades
[cds]
Combo 3 80.3/100 80% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:06.026Ksecret_technique
[finish]
Fluffy_Pillow 80.3/100 80% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:07.031Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), flawless_form(3), shadow_techniques(8), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:08.035Neviscerate
[finish]
Fluffy_Pillow 80.9/100 81% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, flawless_form(4), shadow_techniques(10), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:09.039Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:10.044Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(4), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:11.048Mcoup_de_grace
[finish]
Fluffy_Pillow 81.3/100 81% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(5), shadow_techniques(9), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:12.251Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:13.255Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:14.259Hsymbols_of_death
[cds]
Combo 3 89.5/100 89% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(12), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:14.259Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, power_infusion, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(12), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:15.261Fcold_blood
[cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:15.261Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(8), shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:16.266Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(9), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:17.271Neviscerate
[finish]
Fluffy_Pillow 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(11), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:18.275Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:19.280Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste, tempered_potion
0:20.285Neviscerate
[finish]
Fluffy_Pillow 83.4/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:21.289Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:22.294Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:23.298Ebackstab
[build]
Fluffy_Pillow 91.4/100 91% energy
4.0/7 57% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:24.301Neviscerate
[finish]
Fluffy_Pillow 74.7/100 75% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:25.307Ebackstab
[build]
Fluffy_Pillow 90.1/100 90% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:26.311Ebackstab
[build]
Fluffy_Pillow 89.5/100 90% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste, tempered_potion
0:27.315Hsymbols_of_death
[cds]
Combo 3 72.9/100 73% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste, tempered_potion
0:27.315Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:27.315Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(3), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:28.320Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:29.324Ksecret_technique
[finish]
Fluffy_Pillow 78.4/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:30.329Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste, tempered_potion
0:31.335Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(2), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:32.340Dshadowstrike
[build]
Fluffy_Pillow 77.8/100 78% energy
5.0/7 71% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
0:33.342Mcoup_de_grace
[finish]
Fluffy_Pillow 63.6/100 64% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
0:34.547Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:35.553Lrupture
[finish]
Fluffy_Pillow 85.9/100 86% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_haste
0:36.558Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:37.562Neviscerate
[finish]
Fluffy_Pillow 90.0/100 90% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:38.566Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:39.570Ebackstab
[build]
Fluffy_Pillow 90.0/100 90% energy
3.0/7 43% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:40.574Neviscerate
[finish]
Fluffy_Pillow 70.2/100 70% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:41.579Hsymbols_of_death
[cds]
Combo 3 89.0/100 89% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(5), deeper_daggers, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:41.579Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:41.579Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:42.582Neviscerate
[finish]
Fluffy_Pillow 81.8/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(9), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:43.587Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form(7), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:44.592Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:45.597Neviscerate
[finish]
Fluffy_Pillow 66.0/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:46.604Dshadowstrike
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:47.608Dshadowstrike
[build]
Fluffy_Pillow 59.1/100 59% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:48.864Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:49.869Ebackstab
[build]
Fluffy_Pillow 54.9/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(6), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:51.343Neviscerate
[finish]
Fluffy_Pillow 39.1/100 39% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:52.348Ebackstab
[build]
Fluffy_Pillow 50.1/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:53.723Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_mastery
0:56.158Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:57.363Hsymbols_of_death
[cds]
Combo 3 82.2/100 82% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:57.363Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:57.363Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:58.368Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(7), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
0:59.374Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(6), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:00.379Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:01.382Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:02.385Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:03.389Dshadowstrike
[build]
Fluffy_Pillow 50.3/100 50% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:04.778Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_mastery
1:05.783Ebackstab
[build]
Fluffy_Pillow 55.2/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
1:06.786Lrupture
[finish]
Fluffy_Pillow 34.6/100 35% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:07.790Ebackstab
[build]
Fluffy_Pillow 64.0/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:09.266Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:10.708Neviscerate
[finish]
Fluffy_Pillow 41.1/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
1:11.713Ebackstab
[build]
Fluffy_Pillow 52.5/100 53% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_haste
1:13.242Neviscerate
[finish]
Fluffy_Pillow 37.9/100 38% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:14.246Ebackstab
[build]
Fluffy_Pillow 44.3/100 44% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:17.098Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:19.682Ebackstab
[build]
Fluffy_Pillow 42.0/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
1:22.347Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), flask_of_alchemical_chaos_haste
1:23.552Ebackstab
[build]
Fluffy_Pillow 79.0/100 79% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_haste
1:24.557Ebackstab
[build]
Fluffy_Pillow 50.4/100 50% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, flask_of_alchemical_chaos_haste
1:26.481Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:27.486Ebackstab
[build]
Fluffy_Pillow 46.7/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
1:30.043Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 39.7/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
1:30.193Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:31.198Jflagellation
[cds]
Fluffy_Pillow 16.8/100 17% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.202Hsymbols_of_death
[cds]
Combo 3 28.2/100 28% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.202Qshadow_dance
[stealth_cds]
Combo 3 68.2/100 68% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.202Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.2/100 68% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, flask_of_alchemical_chaos_haste
1:32.202Ksecret_technique
[finish]
Fluffy_Pillow 68.2/100 68% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(5), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:33.205Dshadowstrike
[build]
Fluffy_Pillow 97.6/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(6), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:34.208Neviscerate
[finish]
Fluffy_Pillow 72.0/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:35.212Dshadowstrike
[build]
Fluffy_Pillow 98.4/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_haste
1:36.218Ishadow_blades
[cds]
Combo 3 72.4/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:36.218Neviscerate
[finish]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(19), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:37.223Dshadowstrike
[build]
Fluffy_Pillow 83.2/100 83% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(3), flagellation_buff(26), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:38.227Neviscerate
[finish]
Fluffy_Pillow 57.3/100 57% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_buff(26), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:39.230Dshadowstrike
[build]
Fluffy_Pillow 76.3/100 76% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:40.235Lrupture
[finish]
Fluffy_Pillow 50.3/100 50% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(9), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:41.239Neviscerate
[finish]
Fluffy_Pillow 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:42.243Ebackstab
[build]
Fluffy_Pillow 90.3/100 90% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.247Qshadow_dance
[stealth_cds]
Combo 3 69.3/100 69% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:43.247Neviscerate
[finish]
Fluffy_Pillow 69.3/100 69% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), premeditation, shadow_techniques(6), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:44.252Dshadowstrike
[build]
Fluffy_Pillow 80.3/100 80% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(6), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.257Fcold_blood
[cds]
Combo 3 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(8), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.257Hsymbols_of_death
[cds]
Combo 3 54.4/100 54% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, acrobatic_strikes(10), alacrity(5), cold_blood, escalating_blade(3), flawless_form(2), shadow_techniques(8), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:45.257Ksecret_technique
[finish]
Fluffy_Pillow 94.4/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:46.262Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, ethereal_powerlink, flask_of_alchemical_chaos_vers
1:47.268Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(2), shadow_techniques(3), the_rotten(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
1:48.273Mcoup_de_grace
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_vers
1:49.477Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
1:50.482Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
1:51.488Neviscerate
[finish]
Fluffy_Pillow 85.1/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, flask_of_alchemical_chaos_vers
1:52.494Ebackstab
[build]
Fluffy_Pillow 96.0/100 96% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:53.498Ebackstab
[build]
Fluffy_Pillow 74.8/100 75% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:54.502Neviscerate
[finish]
Fluffy_Pillow 53.6/100 54% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_vers
1:55.505Ebackstab
[build]
Fluffy_Pillow 67.4/100 67% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_vers
1:56.508Ebackstab
[build]
Fluffy_Pillow 46.2/100 46% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
1:58.245Neviscerate
[finish]
Fluffy_Pillow 40.8/100 41% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
1:59.249Ebackstab
[build]
Fluffy_Pillow 51.6/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_vers
2:01.175Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:02.178Ebackstab
[build]
Fluffy_Pillow 46.1/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_vers
2:05.071Rvanish
[stealth_cds]
Combo 3 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:05.071Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade(2), premeditation, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
2:07.030Lrupture
[finish]
Fluffy_Pillow 26.2/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:08.035Ebackstab
[build]
Fluffy_Pillow 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:09.773Hsymbols_of_death
[cds]
Combo 3 33.7/100 34% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:10.021Qshadow_dance
[stealth_cds]
Combo 3 76.4/100 76% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), shadow_techniques(2), the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:10.021Ksecret_technique
[finish]
Fluffy_Pillow 76.4/100 76% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), premeditation, shadow_techniques(2), the_rotten(2), poised_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:11.026Dshadowstrike
[build]
Fluffy_Pillow 87.2/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:12.030Neviscerate
[finish]
Fluffy_Pillow 61.0/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), the_rotten, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:13.035Dshadowstrike
[build]
Fluffy_Pillow 94.8/100 95% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:14.038Mcoup_de_grace
[finish]
Fluffy_Pillow 60.6/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:15.243Dshadowstrike
[build]
Fluffy_Pillow 98.5/100 99% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:16.248Dshadowstrike
[build]
Fluffy_Pillow 72.3/100 72% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:17.253Neviscerate
[finish]
Fluffy_Pillow 46.1/100 46% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:18.258Ebackstab
[build]
Fluffy_Pillow 64.9/100 65% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:19.264Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_crit
2:20.269Ebackstab
[build]
Fluffy_Pillow 54.5/100 55% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:22.774Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:24.872Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:25.877Ebackstab
[build]
Fluffy_Pillow 41.8/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit
2:28.718Ebackstab
[build]
Fluffy_Pillow 40.3/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:31.707Ebackstab
[build]
Fluffy_Pillow 40.4/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
2:34.187Ksecret_technique
[finish]
Fluffy_Pillow 31.1/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), flask_of_alchemical_chaos_crit
2:35.191Ebackstab
[build]
Fluffy_Pillow 50.9/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(3), bolstering_shadows, flask_of_alchemical_chaos_crit
2:37.257Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_crit
2:39.200Lrupture
[finish]
Fluffy_Pillow 25.9/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, bolstering_shadows, flask_of_alchemical_chaos_crit
2:40.205Ebackstab
[build]
Fluffy_Pillow 50.7/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, flask_of_alchemical_chaos_crit
2:42.671Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques, flask_of_alchemical_chaos_crit
2:45.913Ebackstab
[build]
Fluffy_Pillow 40.1/100 40% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flask_of_alchemical_chaos_crit
2:48.884Mcoup_de_grace
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques, flask_of_alchemical_chaos_crit
2:50.086Ebackstab
[build]
Fluffy_Pillow 77.9/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:51.091Ebackstab
[build]
Fluffy_Pillow 48.7/100 49% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:53.762Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:56.244Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:57.249Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(3), deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:59.826Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 37.6/100 38% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, flask_of_alchemical_chaos_crit, storm_sewers_citrine
3:00.043Ebackstab
[build]
Fluffy_Pillow 43.9/100 44% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit, storm_sewers_citrine
3:01.045Jflagellation
[cds]
Fluffy_Pillow 18.7/100 19% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:02.203Hsymbols_of_death
[cds]
Combo 3 31.1/100 31% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, shadow_techniques, flagellation_buff, deeper_daggers, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:02.203Qshadow_dance
[stealth_cds]
Combo 3 71.1/100 71% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:02.203Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 71.1/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_crit
3:02.203Neviscerate
[finish]
Fluffy_Pillow 71.1/100 71% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:03.208Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(11), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:04.213Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, shadow_techniques(5), the_rotten, flagellation_buff(11), deeper_daggers, poised_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:05.217Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form, shadow_techniques(7), the_rotten, flagellation_buff(21), deeper_daggers, poised_shadows, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:06.222Ishadow_blades
[cds]
Combo 3 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), flagellation_buff(21), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:06.222Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(3), flagellation_buff(21), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:07.227Dshadowstrike
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), flagellation_buff(28), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:08.233Neviscerate
[finish]
Fluffy_Pillow 58.5/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_buff(28), deeper_daggers, bolstering_shadows, seabed_leviathans_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:09.238Neviscerate
[finish]
Fluffy_Pillow 85.4/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:10.242Ebackstab
[build]
Fluffy_Pillow 96.2/100 96% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:11.247Lrupture
[finish]
Fluffy_Pillow 75.1/100 75% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:12.252Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:13.255Hsymbols_of_death
[cds]
Combo 3 70.8/100 71% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:13.255Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:13.255Mcoup_de_grace
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(4), flawless_form(4), premeditation, shadow_techniques(8), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:14.457Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:15.463Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), premeditation, shadow_techniques(7), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:16.469Fcold_blood
[cds]
Combo 3 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:16.469Ksecret_technique
[finish]
Fluffy_Pillow 73.9/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_crit
3:17.474Neviscerate
[finish]
Fluffy_Pillow 89.7/100 90% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
3:18.480Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(8), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:19.485Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:20.491Dshadowstrike
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:21.496Neviscerate
[finish]
Fluffy_Pillow 50.6/100 51% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:22.501Ebackstab
[build]
Fluffy_Pillow 69.4/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:23.505Neviscerate
[finish]
Fluffy_Pillow 40.2/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
3:24.509Ebackstab
[build]
Fluffy_Pillow 59.1/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_crit
3:25.824Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:27.580Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:28.583Hsymbols_of_death
[cds]
Combo 3 47.0/100 47% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
3:28.583Qshadow_dance
[stealth_cds]
Combo 3 87.0/100 87% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:28.583Dshadowstrike
[build]
Fluffy_Pillow 87.0/100 87% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:29.589Neviscerate
[finish]
Fluffy_Pillow 60.9/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:30.594Ksecret_technique
[finish]
Fluffy_Pillow 86.7/100 87% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(2), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_crit
3:31.597Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_crit
3:32.600Dshadowstrike
[build]
Fluffy_Pillow 65.8/100 66% energy
5.0/7 71% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:33.605Mcoup_de_grace
[finish]
Fluffy_Pillow 39.7/100 40% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:34.809Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_crit
3:35.813Neviscerate
[finish]
Fluffy_Pillow 51.5/100 51% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:36.818Ebackstab
[build]
Fluffy_Pillow 62.3/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:37.823Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
1.0/7 14% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:40.189Ebackstab
[build]
Fluffy_Pillow 42.5/100 43% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
3:41.751Lrupture
[finish]
Fluffy_Pillow 27.3/100 27% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
3:42.754Ebackstab
[build]
Fluffy_Pillow 52.1/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_mastery
3:44.635Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(7), shadow_techniques, flask_of_alchemical_chaos_mastery
3:45.641Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
3:48.489Ebackstab
[build]
Fluffy_Pillow 40.7/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
3:49.915Hsymbols_of_death
[cds]
Combo 3 16.0/100 16% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, flask_of_alchemical_chaos_mastery
3:50.021Qshadow_dance
[stealth_cds]
Combo 3 57.2/100 57% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:50.021Neviscerate
[finish]
Fluffy_Pillow 57.2/100 57% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:51.024Dshadowstrike
[build]
Fluffy_Pillow 81.0/100 81% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:52.030Ksecret_technique
[finish]
Fluffy_Pillow 54.8/100 55% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form, shadow_techniques(4), the_rotten, deeper_daggers, poised_shadows, flask_of_alchemical_chaos_mastery
3:53.035Dshadowstrike
[build]
Fluffy_Pillow 93.6/100 94% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:54.039Neviscerate
[finish]
Fluffy_Pillow 67.4/100 67% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:55.044Dshadowstrike
[build]
Fluffy_Pillow 86.2/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(6), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:56.049Mcoup_de_grace
[finish]
Fluffy_Pillow 60.0/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:57.253Dshadowstrike
[build]
Fluffy_Pillow 97.9/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:58.260Neviscerate
[finish]
Fluffy_Pillow 63.7/100 64% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
3:59.264Ebackstab
[build]
Fluffy_Pillow 82.5/100 83% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:00.268Ebackstab
[build]
Fluffy_Pillow 61.3/100 61% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:01.569Neviscerate
[finish]
Fluffy_Pillow 35.3/100 35% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), deeper_daggers, flask_of_alchemical_chaos_mastery
4:02.575Ebackstab
[build]
Fluffy_Pillow 49.1/100 49% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:05.096Rvanish
[stealth_cds]
Combo 3 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:05.096Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
3.0/7 43% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), premeditation, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_mastery
4:07.565Neviscerate
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:08.569Ebackstab
[build]
Fluffy_Pillow 51.3/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:10.839Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:12.717Lrupture
[finish]
Fluffy_Pillow 26.4/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:13.722Ebackstab
[build]
Fluffy_Pillow 47.8/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:16.243Ebackstab
[build]
Fluffy_Pillow 40.5/100 40% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:19.151Ebackstab
[build]
Fluffy_Pillow 41.5/100 42% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), windsingers_runed_citrine_Vers, flask_of_alchemical_chaos_haste
4:21.526Neviscerate
[finish]
Fluffy_Pillow 36.5/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), flask_of_alchemical_chaos_haste
4:22.532Ebackstab
[build]
Fluffy_Pillow 47.9/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:24.770Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:27.501Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:28.507Ebackstab
[build]
Fluffy_Pillow 42.8/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:29.835Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 21.8/100 22% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:31.183Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:32.186Jflagellation
[cds]
Fluffy_Pillow 12.5/100 13% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, deeper_daggers, fathomdwellers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:33.191Hsymbols_of_death
[cds]
Combo 3 27.9/100 28% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, fathomdwellers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:33.191Qshadow_dance
[stealth_cds]
Combo 3 67.9/100 68% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:33.191Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 67.9/100 68% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, errant_manaforge_emission, flask_of_alchemical_chaos_haste
4:33.191Ksecret_technique
[finish]
Fluffy_Pillow 67.9/100 68% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:34.196Dshadowstrike
[build]
Fluffy_Pillow 97.4/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:35.200Mcoup_de_grace
[finish]
Fluffy_Pillow 71.8/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:36.404Ishadow_blades
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:36.404Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(9), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:37.409Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(9), flagellation_buff(24), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:38.414Neviscerate
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:39.418Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:40.423Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(8), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:41.427Neviscerate
[finish]
Fluffy_Pillow 84.7/100 85% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:42.433Hsymbols_of_death
[cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), flagellation_buff(30), deeper_daggers, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:42.433Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:43.437Lrupture
[finish]
Fluffy_Pillow 78.8/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_buff(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:44.444Qshadow_dance
[stealth_cds]
Combo 3 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:44.444Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(9), premeditation, shadow_techniques(5), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:45.448Fcold_blood
[cds]
Combo 3 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:45.448Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, escalating_blade(2), flawless_form(8), shadow_techniques(7), flagellation_persist(30), deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:46.453Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:47.458Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_mastery
4:48.462Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:49.467Dshadowstrike
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_mastery
4:50.472Mcoup_de_grace
[finish]
Fluffy_Pillow 58.5/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:51.676Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_persist(30), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_mastery
4:52.680Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
4:53.685Neviscerate
[finish]
Fluffy_Pillow 78.8/100 79% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
4:54.690Ebackstab
[build]
Fluffy_Pillow 92.7/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(4), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
4:55.695Ebackstab
[build]
Fluffy_Pillow 63.5/100 64% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), flagellation_persist(30), deeper_daggers, flask_of_alchemical_chaos_mastery
4:56.701Neviscerate
[finish]
Fluffy_Pillow 42.4/100 42% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery
4:57.705Ebackstab
[build]
Fluffy_Pillow 56.2/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_mastery
4:59.261Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (26976)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit22.02%16.97%3476
Haste2.35%2.79%1843
Versatility24.83%22.21%17321
Attack Power6162857457938
Mastery66.00%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Void Reaper's Contract
ilevel: 639, stats: { +3,607 Agi }
item effects: { equip: Void Reaper's Contract }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Combo 3"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=void_reapers_contract,id=212456,bonus_id=6652/10356/10299/1540/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Equipped : 1,469,763 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,469,763.31,469,763.32,927.6 / 0.199%190,733.5 / 13.0%49,160.1
Resource Out In Waiting APM Active
Energy29.929.711.69%57.1100.0%
TalentCUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA
Set Bonus
Professions
  • alchemy: 29
  • leatherworking: 100

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Equipped1,469,763
Auto Attack 0 (70,198)0.0% (4.8%)3.9122.31s5,338,3790

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 46,8503.2%352.70.98s39,65640,539Direct352.738,39977,44839,65519.5%16.5%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage352.74352.740.000.000.000.97820.000013,988,138.0418,249,550.0323.35%40,539.4540,539.45
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.04%225.8915829238,398.9223,00164,90238,416.3836,69640,7068,673,49011,316,56923.36%
crit19.45%68.623611077,447.5145,615129,97877,501.8669,79987,3675,314,6486,932,98123.34%
miss16.51%58.2335850.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 23,3491.6%352.60.98s19,77620,150Direct352.619,12938,64219,77519.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage352.58352.580.000.000.000.98140.00006,972,428.489,096,274.8523.35%20,150.4220,150.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.19%226.3315630319,129.4611,33032,31819,136.3318,16420,2974,329,6885,648,98623.35%
crit19.40%68.393810238,641.9523,14864,73438,670.4535,00443,2182,642,7413,447,28823.34%
miss16.41%57.8534880.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Backstab 30,1822.1%75.03.69s120,415119,876Direct75.072,988188,581120,38741.0%0.0%

Stats Details: Backstab

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.0075.000.000.000.001.00450.00009,031,195.7011,815,287.5123.56%119,875.70119,875.70
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.98%44.23256572,988.1757,139141,74573,006.6168,71077,5643,228,9624,226,06423.58%
crit41.02%30.771152188,581.04125,912412,226188,695.54174,058207,0805,802,2347,589,22323.56%

Action Details: Backstab

  • id:53
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing {$=}{{$s2=0}*{$=}<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target{$?s319949=true}[, and critical strikes apply Find Weakness for {$319949s1=10} sec][]. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [E]:75.00

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical ChanceImproved Backstab3199492ADD0.150
Coup de Grace 89,618 (127,934)6.1% (8.7%)13.222.51s2,883,4112,393,996Direct39.6 (77.9)518,5891,045,751674,38929.5% (29.5%)0.0%

Stats Details: Coup De Grace

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2439.650.000.000.001.20450.000026,735,540.3534,805,747.0523.19%2,393,995.822,393,995.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.46%27.941742518,588.57119,7431,882,060518,815.03330,829698,31414,489,97718,865,72423.20%
crit29.54%11.713241,045,751.07239,8463,813,8031,044,975.22502,3021,994,08212,245,56415,940,02323.18%

Action Details: Coup De Grace

  • id:441776
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.2000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:441776
  • name:Coup de Grace
  • school:physical
  • tooltip:
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}

Action Priority List

    finish
    [M]:13.24
  • if_expr:debuff.fazed.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (Coup de Grace) (_bonus) 38,3162.6%0.00.00s00Direct38.2229,981464,220299,15729.5%0.0%

Stats Details: Eviscerate Coup De Grace Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0038.210.000.000.000.00000.000011,429,541.0011,429,541.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.48%26.931540229,981.3457,087826,043230,172.87154,113318,5296,191,2106,191,2100.00%
crit29.52%11.28224464,219.74114,3451,623,543465,033.31235,158871,8765,238,3315,238,3310.00%

Action Details: Eviscerate Coup De Grace Bonus

  • id:462244
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:462244
  • name:Eviscerate (Coup de Grace)
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Elemental Focusing Lens 0 (20,035)0.0% (1.4%)0.00.00s00

Stats Details: Elemental Focusing Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Elemental Focusing Lens

  • id:461180
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461180
  • name:Elemental Focusing Lens
  • school:physical
  • tooltip:
  • description:
    Elemental Focusing Lens (Onyx) 20,0351.4%22.212.90s269,5950Direct22.2269,7150269,7150.0%0.0%

Stats Details: Elemental Focusing Lens Onyx

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.2022.190.000.000.000.00000.00005,984,576.825,984,576.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.19939269,715.03260,578318,025269,660.62262,531279,1175,984,5775,984,5770.00%

Action Details: Elemental Focusing Lens Onyx

  • id:461191
  • school:shadow
  • range:60.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:202669.34
  • base_dd_max:202669.34
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461191
  • name:Elemental Focusing Lens
  • school:shadow
  • tooltip:
  • description:{$@spelldesc461177=Your damaging spells and abilities have a chance to deal {$=}{{$=}<rolemult>*{$s1=35438}} damage to your target. The magic school chosen is based upon your selection of socketed Khaz Algar gems.}
Eviscerate 255,910 (366,174)17.4% (24.9%)68.44.35s1,597,9721,590,817Direct68.4 (135.4)860,0501,743,7811,117,56829.1% (29.1%)0.0%

Stats Details: Eviscerate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage68.3568.350.000.000.001.00450.000076,346,371.3399,313,015.9223.13%1,590,817.341,590,817.34
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.89%48.453266860,049.53210,8622,477,438859,907.32698,6351,036,76141,660,46154,197,94023.13%
crit29.11%19.906321,743,780.67422,3574,832,9731,742,322.991,190,0032,550,11734,685,91045,115,07623.12%

Action Details: Eviscerate

  • id:196819
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [N]:68.36

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
    Eviscerate (_bonus) 110,2637.5%67.14.42s490,2490Direct67.1377,543766,647490,28729.0%0.0%

Stats Details: Eviscerate Bonus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage67.0767.070.000.000.000.00000.000032,882,328.9532,882,328.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.98%47.613065377,542.81100,5271,074,801377,645.36304,001456,41917,968,33517,968,3350.00%
crit29.02%19.46833766,646.59201,3562,112,724766,635.35525,5451,116,21214,913,99414,913,9940.00%

Action Details: Eviscerate Bonus

  • id:328082
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:328082
  • name:Eviscerate
  • school:shadow
  • tooltip:
  • description:{$@spelldesc196819=Finishing move that disembowels the target, causing damage per combo point.{$?s382511=true}[ Targets with Find Weakness suffer an additional {$382511s1=30}% damage as Shadow.][] 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Flagellation 1,027 (21,072)0.1% (1.4%)3.791.34s1,705,2571,697,990Direct3.7 (27.5)69,669138,94682,84218.9% (20.1%)0.0%

Stats Details: Flagellation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.693.690.000.000.001.00450.0000305,630.86305,630.860.00%1,697,990.441,697,990.44
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.06%2.990469,669.0160,925139,09769,359.77096,674208,459208,4590.00%
crit18.94%0.7003138,945.81122,033264,74174,426.550255,48397,17297,1720.00%

Action Details: Flagellation

  • id:384631
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:384631
  • name:Flagellation
  • school:shadow
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.

Action Priority List

    cds
    [J]:3.70
  • if_expr:combo_points>=5|fight_remains<=25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Flagellation (_damage) 20,0451.4%0.00.00s00Direct23.8209,356419,708251,92320.3%0.0%

Stats Details: Flagellation Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.770.000.000.000.00000.00005,988,819.695,988,819.690.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.73%18.951027209,356.0573,719451,823209,163.20171,783240,9123,966,4473,966,4470.00%
crit20.27%4.82012419,708.37153,474862,952416,262.290831,2022,022,3732,022,3730.00%

Action Details: Flagellation Damage

  • id:394757
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394757
  • name:Flagellation
  • school:shadow
  • tooltip:
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Instant Poison 12,1810.8%0.00.00s00Direct281.410,80321,73512,92419.4%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00281.410.000.000.000.00000.00003,636,990.903,636,990.900.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.59%226.7915631510,802.707,51417,71610,806.6110,26311,5882,449,8232,449,8230.00%
crit19.41%54.61248321,735.4715,05135,47921,748.9519,33024,5841,187,1681,187,1680.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Rupture 98,887 (117,056)6.7% (8.0%)9.531.34s3,683,0713,666,582Periodic166.5 (333.1)135,754281,501177,29828.5% (28.5%)0.0%97.0%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.490.00166.54166.547.031.00451.741029,521,738.8929,521,738.890.00%116,691.903,666,581.72
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.49%119.0682154135,754.0774439,488135,853.49120,870151,73316,161,92816,161,9280.00%
crit28.51%47.472674281,500.65478885,048281,866.91219,335352,04513,359,81113,359,8110.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    finish
    [L]:9.49
  • if_expr:!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
    Rupture (_replicating_shadows) 18,1691.2%166.51.76s32,5720Periodic166.524,99751,63732,57228.5%0.0%0.0%

Stats Details: Rupture Replicating Shadows

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage166.540.000.00166.540.000.00000.00005,424,451.485,424,451.480.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.54%119.148216024,997.279,67181,02025,010.9221,78528,2352,977,6922,977,6920.00%
crit28.46%47.39237351,637.3719,371156,62651,684.4239,09663,6952,446,7592,446,7590.00%

Action Details: Rupture Replicating Shadows

  • id:394031
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394031
  • name:Rupture
  • school:shadow
  • tooltip:
  • description:{$@spelldesc382506=Rupture deals an additional {$s1=20}% damage as Shadow and applies to {$s4=1} additional nearby enemy.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountSubtlety Rogue1370359PCT15.0%
Spell Periodic AmountSubtlety Rogue13703510PCT-13.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Secret Technique 0 (271,905)0.0% (18.5%)16.018.90s5,080,6945,057,979

Stats Details: Secret Technique

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.970.000.000.000.001.00450.00000.000.000.00%5,057,978.925,057,978.92

Action Details: Secret Technique

  • id:280719
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:280719
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.

Action Priority List

    finish
    [K]:15.97
  • if_expr:variable.secret

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_player) 69,7524.7%0.00.00s00Direct16.0687,9822,101,7031,303,89143.5%0.0%

Stats Details: Secret Technique Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0015.970.000.000.000.00000.000020,815,544.3427,132,585.6623.28%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.48%9.02314687,981.91158,6221,614,362688,565.32440,684907,4496,205,1678,112,20123.52%
crit43.52%6.953122,101,702.57303,5724,308,3042,137,770.011,317,7903,239,11114,610,37819,020,38523.18%

Action Details: Secret Technique Player

  • id:280720
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:280720
  • name:Secret Technique
  • school:physical
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
    Secret Technique (_clones) 202,15313.8%0.00.00s00Direct31.8996,8503,023,0151,895,42144.3%0.0%

Stats Details: Secret Technique Clones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0031.840.000.000.000.00000.000060,329,611.4460,329,611.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.69%17.73928996,849.92222,2922,334,559998,318.99764,8351,261,62717,676,27617,676,2760.00%
crit44.31%14.116243,023,014.80445,2516,230,3203,052,084.662,100,6474,330,96242,653,33542,653,3350.00%

Action Details: Secret Technique Clones

  • id:282449
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.900
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:6
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:282449
  • name:Secret Technique
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280719=Finishing move that creates shadow clones of yourself. You and your shadow clones each perform a piercing attack on all enemies near your target, dealing Physical damage to the primary target and reduced damage to other targets. 1 point : {$=}{{$280720m1=0}*1*{$=}<mult>} total damage 2 points: {$=}{{$280720m1=0}*2*{$=}<mult>} total damage 3 points: {$=}{{$280720m1=0}*3*{$=}<mult>} total damage 4 points: {$=}{{$280720m1=0}*4*{$=}<mult>} total damage 5 points: {$=}{{$280720m1=0}*5*{$=}<mult>} total damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$280720m1=0}*6*{$=}<mult>} total damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$280720m1=0}*7*{$=}<mult>} total damage][] Cooldown is reduced by {$s5=1} sec for every combo point you spend.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Direct AmountVeiltouched3820173PCT5.0%
Spell Periodic AmountVeiltouched3820174PCT5.0%
Spell Direct AmountSecret Stratagem3943204PCT5.0%
Spell Periodic AmountSecret Stratagem3943205PCT5.0%
Spell CooldownDisorienting Strikes4412741PCT-10.0%
Shadow Blades 0 (104,275)0.0% (7.1%)3.690.85s8,596,4950

Stats Details: Shadow Blades

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.620.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Blades

  • id:121471
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.

Action Priority List

    cds
    [I]:3.63
  • if_expr:variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
    Shadow Blades (_attack) 104,2757.1%383.11.19s81,2910Periodic383.181,275081,2750.0%0.0%0.0%

Stats Details: Shadow Blades Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage383.130.000.00383.130.000.00000.000031,144,930.5731,144,930.570.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%383.1328346981,275.40201,096,11981,338.7468,78596,59431,144,93131,144,9310.00%

Action Details: Shadow Blades Attack

  • id:279043
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2469.74
  • base_dd_max:2469.74
  • base_dd_mult:1.05
  • base_multiplier:1.00

Spelldata

  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVeiltouched3820171PCT5.0%
Spell Periodic AmountVeiltouched3820172PCT5.0%
Shadowstrike 117,7888.0%52.25.77s672,012669,012Direct52.2280,873915,409672,13961.7%0.0%

Stats Details: Shadowstrike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage52.2452.240.000.000.001.00450.000035,105,082.5045,774,372.5623.31%669,012.30669,012.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit38.35%20.031130280,872.54130,261407,378280,857.93255,165308,2755,626,3277,330,08123.25%
crit61.65%32.212144915,408.88287,0431,411,743916,190.38842,8101,001,52429,478,75538,444,29123.32%

Action Details: Shadowstrike

  • id:185438
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage. While Stealthed, you strike through the shadows and appear behind your target up to {$=}{5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [D]:52.22

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Squall Sailor's Citrine 3,7650.3%2.367.35s481,4380Direct2.3400,339806,689481,67120.0%0.0%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.342.340.000.000.000.00000.00001,125,805.171,125,805.170.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.99%1.8709400,338.85377,346481,967337,307.890465,030748,517748,5170.00%
crit20.01%0.4705806,688.98755,824942,313301,522.300942,313377,288377,2880.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171984.10
  • base_dd_max:171984.10
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine (_damage) 8260.1%2.378.92s108,8270Direct2.391,615183,670108,85518.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.272.270.000.000.000.00000.0000246,667.39246,667.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.31%1.840891,615.0783,958119,00077,969.470114,085168,839168,8390.00%
crit18.69%0.4205183,670.38168,168239,42560,861.230227,66777,82877,8280.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68081.01
  • base_dd_max:68081.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Suffocating Darkness 47,6483.2%19.215.47s743,1850Periodic107.4132,6710132,6710.0%0.0%71.9%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.170.00107.40107.4012.280.00002.000014,243,929.9114,243,929.910.00%66,313.450.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%107.4057158132,671.0160,995223,326131,777.2780,285177,90914,243,93014,243,9300.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:47440.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Thunderlord's Crackling Citrine 68,6984.7%34.48.48s595,9690Direct34.4498,556998,748595,96619.5%0.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage34.4434.440.000.000.000.00000.000020,525,634.8920,525,634.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.52%27.731453498,555.83453,001888,851498,212.63463,630559,54413,824,89213,824,8920.00%
crit19.48%6.71020998,747.84907,3601,713,712997,224.1601,513,7256,700,7426,700,7420.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309697.73
  • base_dd_max:309697.73
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,4680.3%2.366.26s575,5170Direct2.3480,656963,336576,19619.7%0.0%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.322.320.000.000.000.00000.00001,334,434.201,334,434.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.33%1.8607480,656.15452,539574,444401,431.130564,284895,173895,1730.00%
crit19.67%0.4605963,336.44906,4361,135,034352,518.0401,114,359439,262439,2620.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206254.58
  • base_dd_max:206254.58
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Unseen Blade 85,5595.8%58.05.19s440,4910Direct58.0367,791740,396440,40819.5%0.0%

Stats Details: Unseen Blade

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage57.9557.950.000.000.000.00000.000025,526,710.4533,344,601.4623.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.49%46.643065367,790.84220,828566,280368,043.08342,587404,03917,157,43022,413,67023.45%
crit19.51%11.31229740,395.63442,3191,145,799740,919.80566,652949,7538,369,28110,930,93123.44%

Action Details: Unseen Blade

  • id:441144
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441144
  • name:Unseen Blade
  • school:physical
  • tooltip:
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
Simple Action Stats Execute Interval
Equipped
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 3.590.60s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.550.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [F]:3.55
  • if_expr:cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
treacherous_transmitter 3.791.13s

Stats Details: Cryptic Instructions

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.700.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cryptic Instructions

  • id:449946
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:449946
  • name:Cryptic Instructions
  • school:physical
  • tooltip:
  • description:Receive cryptic instructions from somewhere in the Twisting Nether to reveal your next task. It's probably nothing, so complete it to gain {$446209s1=9013} {$=}pri for {$449954d=15 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 25.511.29s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.463.11s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.360.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.80
  • base_dd_max:309539.80
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)}][{$=}{{$462342s3=10779}*({$s2=1960}/100)}] health to each of them.}
cyrces_circlet 2.368.39s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.300.0067.460.000.430.00000.83570.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.19
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)}][{$=}{{$462342s3=10779}*({$s2=1634}/100)}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5308.60s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.460.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [G]:1.45
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
Slice and Dice (recuperator) 98.43.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal98.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Roaring War-Queen's Citrine 2.365.97s

Stats Details: Roaring Warqueens Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.260.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Roaring Warqueens Citrine

  • id:462964
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462964
  • name:Roaring War-Queen's Citrine
  • school:froststorm
  • tooltip:
  • description:{$@spelldesc462526=Your spells and abilities have a low chance of triggering the Singing Thunder Citrine effects of {$s2=4} nearby allies. Whenever an allied player dies, this effect is triggered immediately.}
Shadow Dance 13.323.11s

Stats Details: Shadow Dance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.260.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadow Dance

  • id:185313
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.

Action Priority List

    stealth_cds
    [Q]:13.26
  • if_expr:variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownImproved Shadow Dance3939722ADD2000.000
Modify Cooldown Charge (Category)Double Dance3949301SET1.000
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Storm Sewer's Citrine 2.378.92s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.272.270.000.000.000.00000.00000.001,556,129.730.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.27080.00000.000001,556,13090.66%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Storm Sewer's Citrine (_damage) 8260.1%2.378.92s108,8270Direct2.391,615183,670108,85518.7%0.0%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.272.270.000.000.000.00000.0000246,667.39246,667.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.31%1.840891,615.0783,958119,00077,969.470114,085168,839168,8390.00%
crit18.69%0.4205183,670.38168,168239,42560,861.230227,66777,82877,8280.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:68081.01
  • base_dd_max:68081.01
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Symbols of Death 14.221.27s

Stats Details: Symbols Of Death

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Symbols Of Death

  • id:212283
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:25.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:energy
  • energize_amount:40.0

Spelldata

  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.

Action Priority List

    cds
    [H]:14.23
  • if_expr:(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time (Category)Swift Death3943091SET-5000.000
Modify Cooldown Charge (Category)Death Perception4696421SET2.000
Vanish 2.9122.31s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.930.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Equipped
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [R]:2.93
  • if_expr:energy>=40&!buff.subterfuge.up&effective_combo_points<=3
cyrces_circlet 2.468.63s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.400.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1588.1151.7s0.5s275.2s99.94%100.00%578.4 (578.4)0.1

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:27.3s / 339.3s
  • trigger_min/max:0.0s / 4.3s
  • trigger_pct:100.00%
  • duration_min/max:8.2s / 359.9s
  • uptime_min/max:99.17% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.24%
  • acrobatic_strikes_3:0.20%
  • acrobatic_strikes_4:0.18%
  • acrobatic_strikes_5:0.15%
  • acrobatic_strikes_6:0.16%
  • acrobatic_strikes_7:0.15%
  • acrobatic_strikes_8:0.16%
  • acrobatic_strikes_9:0.15%
  • acrobatic_strikes_10:98.31%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity2.382.1117.0s3.5s124.9s97.26%0.00%73.6 (76.3)1.3

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.1s / 339.2s
  • trigger_min/max:1.0s / 45.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.8s
  • uptime_min/max:87.75% / 99.44%

Stack Uptimes

  • alacrity_1:3.16%
  • alacrity_2:2.28%
  • alacrity_3:1.82%
  • alacrity_4:1.72%
  • alacrity_5:88.28%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.57%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.66%

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Shadows16.00.018.9s18.9s6.9s37.07%100.00%0.0 (0.0)15.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_bolstering_shadows
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:31.41% / 40.65%

Stack Uptimes

  • bolstering_shadows_1:37.07%

Spelldata

  • id:455577
  • name:Bolstering Shadows
  • tooltip:Eviscerate, Rupture, and Black Powder damage increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Cold Blood3.50.090.6s90.6s0.1s0.00%1.41%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:82.8s / 100.2s
  • trigger_min/max:82.8s / 100.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.2s
  • uptime_min/max:0.00% / 0.07%

Stack Uptimes

  • cold_blood_1:0.00%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Cryptic Instructions1.30.0128.7s109.4s4.3s1.90%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_cryptic_instructions
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 277.8s
  • trigger_min/max:90.0s / 245.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.2s
  • uptime_min/max:0.00% / 7.02%

Stack Uptimes

  • cryptic_instructions_1:1.90%

Spelldata

  • id:449948
  • name:Cryptic Instructions
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Danse Macabre13.347.823.1s23.1s8.2s36.46%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_danse_macabre
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.06/stack
  • periodic:1.00 + 0.06/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:8.0s / 73.2s
  • trigger_min/max:8.0s / 73.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.39% / 39.38%

Stack Uptimes

  • danse_macabre_1:0.04%
  • danse_macabre_2:4.55%
  • danse_macabre_3:6.59%
  • danse_macabre_4:16.53%
  • danse_macabre_5:8.75%
  • danse_macabre_6:0.01%

Spelldata

  • id:393969
  • name:Danse Macabre
  • tooltip:Attacks that generate or spend combo points deal {$=}w1% increased damage.
  • description:{$@spelldesc382528=Shadow Dance increases the damage of your attacks that generate or spend combo points by {$393969s1=6}%, increased by an additional {$393969s1=6}% for each different attack used.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deeper Daggers7.674.040.8s3.7s35.4s90.04%95.67%74.0 (74.0)6.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_deeper_daggers
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 183.5s
  • trigger_min/max:1.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 165.5s
  • uptime_min/max:81.00% / 96.19%

Stack Uptimes

  • deeper_daggers_1:90.04%

Spelldata

  • id:383405
  • name:Deeper Daggers
  • tooltip:Shadow damage dealt increased by {$=}w1%.
  • description:{$@spelldesc341549=Eviscerate and Black Powder increase your Shadow damage dealt by |cFFFFFFFF{$=}{{$s1=30}}.1%|r for {$341550d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Disorienting Strikes16.00.018.9s18.9s3.4s18.41%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_disorienting_strikes
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.2s / 57.2s
  • trigger_min/max:9.2s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s
  • uptime_min/max:15.27% / 21.47%

Stack Uptimes

  • disorienting_strikes_1:12.20%
  • disorienting_strikes_2:6.21%

Spelldata

  • id:441274
  • name:Disorienting Strikes
  • tooltip:
  • description:{$?a137036=false}[Killing Spree][Secret Technique] has {$s1=10}% reduced cooldown and allows your next {$s2=2} strikes of Unseen Blade to ignore its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Errant Manaforge Emission1.20.0132.4s112.3s4.0s1.63%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_errant_manaforge_emission
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.6s
  • trigger_min/max:90.0s / 188.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s
  • uptime_min/max:0.00% / 6.28%

Stack Uptimes

  • errant_manaforge_emission_1:1.63%

Spelldata

  • id:449952
  • name:Errant Manaforge Emission
  • tooltip:
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Escalating Blade14.143.922.0s5.2s17.3s81.62%0.00%3.1 (3.1)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_escalating_blade
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.4s / 60.6s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.4s
  • uptime_min/max:65.82% / 93.01%

Stack Uptimes

  • escalating_blade_1:24.90%
  • escalating_blade_2:22.31%
  • escalating_blade_3:22.35%
  • escalating_blade_4:12.06%

Spelldata

  • id:441786
  • name:Escalating Blade
  • tooltip:Building to a Coup de Grace.
  • description:{$@spelldesc441423=After {$441786s1=4} strikes with Unseen Blade, your next {$?a137036=false}[Dispatch][Eviscerate] will be performed as a Coup de Grace, functioning as if it had consumed {$s3=5} additional combo points. If the primary target is Fazed, gain {$s2=5} stacks of Flawless Form.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Ethereal Powerlink3.70.090.8s90.8s14.7s18.14%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_ethereal_powerlink
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:15047.00

Trigger Details

  • interval_min/max:83.5s / 181.5s
  • trigger_min/max:83.5s / 181.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:12.70% / 20.86%

Stack Uptimes

  • ethereal_powerlink_1:18.14%

Spelldata

  • id:449954
  • name:Ethereal Powerlink
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc446209=}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.10.281.0s68.8s15.4s10.85%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.19
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4790.93

Trigger Details

  • interval_min/max:15.1s / 322.2s
  • trigger_min/max:1.0s / 308.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.3s
  • uptime_min/max:0.00% / 35.37%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:10.85%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation (_buff)3.723.991.3s9.7s11.8s14.63%0.00%14.2 (95.9)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation_buff
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:1.00%

Trigger Details

  • interval_min/max:90.0s / 98.1s
  • trigger_min/max:1.0s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.88%

Stack Uptimes

  • flagellation_buff_1:1.30%
  • flagellation_buff_7:0.04%
  • flagellation_buff_8:0.78%
  • flagellation_buff_9:0.63%
  • flagellation_buff_10:0.53%
  • flagellation_buff_11:0.46%
  • flagellation_buff_12:0.00%
  • flagellation_buff_13:0.02%
  • flagellation_buff_14:0.01%
  • flagellation_buff_15:0.71%
  • flagellation_buff_16:0.02%
  • flagellation_buff_17:0.02%
  • flagellation_buff_18:0.05%
  • flagellation_buff_19:0.46%
  • flagellation_buff_20:0.35%
  • flagellation_buff_21:0.31%
  • flagellation_buff_22:0.01%
  • flagellation_buff_23:0.02%
  • flagellation_buff_24:0.18%
  • flagellation_buff_25:0.86%
  • flagellation_buff_26:0.39%
  • flagellation_buff_27:0.19%
  • flagellation_buff_28:0.20%
  • flagellation_buff_29:0.01%
  • flagellation_buff_30:7.09%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation (_persist)3.70.091.0s91.0s11.8s14.21%0.00%0.0 (0.0)3.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation_persist
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:-0.00%

Trigger Details

  • interval_min/max:78.5s / 98.1s
  • trigger_min/max:78.5s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s
  • uptime_min/max:12.36% / 16.25%

Stack Uptimes

  • flagellation_persist_30:14.21%

Spelldata

  • id:394758
  • name:Flagellation
  • tooltip:Mastery increased by {$=}{{$=}W1*$mas}.1%.
  • description:{$@spelldesc384631=Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.20.7110.0s74.5s35.6s25.56%0.00%3.0 (3.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 330.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 85.64%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.56%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6114.7s77.5s35.6s24.57%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.5s / 339.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s
  • uptime_min/max:0.00% / 72.29%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.57%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.7s76.6s35.2s24.92%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 343.3s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 219.1s
  • uptime_min/max:0.00% / 83.94%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.92%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6110.3s75.5s35.2s24.95%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.8s / 330.7s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 165.5s
  • uptime_min/max:0.00% / 71.58%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.95%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flawless Form87.20.039.6s3.4s59.4s95.32%100.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flawless_form
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.03/stack
  • periodic:1.00 + 0.03/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Stack Uptimes

  • flawless_form_1:11.56%
  • flawless_form_2:8.81%
  • flawless_form_3:11.74%
  • flawless_form_4:9.74%
  • flawless_form_5:2.73%
  • flawless_form_6:4.44%
  • flawless_form_7:5.95%
  • flawless_form_8:11.15%
  • flawless_form_9:18.53%
  • flawless_form_10:8.86%
  • flawless_form_11:1.47%
  • flawless_form_12:0.07%
  • flawless_form_13:0.00%
  • flawless_form_14:0.02%
  • flawless_form_15:0.16%
  • flawless_form_16:0.09%
  • flawless_form_17:0.01%
  • flawless_form_18:0.00%

Spelldata

  • id:441326
  • name:Flawless Form
  • tooltip:Finishing moves deal {$s1=3}% increased damage.
  • description:{$@spelldesc441321=Unseen Blade and {$?a137036=false}[Killing Spree][Secret Technique] increase the damage of your finishing moves by {$441326s1=3}% for {$441326d=12 seconds}. Multiple applications may overlap.}
  • max_stacks:30
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Nascent Empowerment (Crit)1.90.287.2s72.9s16.9s10.94%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:2.6s / 335.5s
  • trigger_min/max:0.2s / 335.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.3s
  • uptime_min/max:0.00% / 38.73%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.94%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.288.4s74.2s16.9s10.79%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:6.3s / 329.2s
  • trigger_min/max:0.2s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.3s
  • uptime_min/max:0.00% / 43.61%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.79%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.287.6s72.2s17.2s11.16%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:6.3s / 334.4s
  • trigger_min/max:0.2s / 334.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 62.4s
  • uptime_min/max:0.00% / 36.15%

Stack Uptimes

  • nascent_empowerment_Mastery_1:11.17%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.288.0s75.4s16.6s10.58%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:3329.01

Trigger Details

  • interval_min/max:1.7s / 324.0s
  • trigger_min/max:0.2s / 324.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 48.9s
  • uptime_min/max:0.00% / 42.00%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.59%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Poised Shadows13.80.522.1s21.3s3.7s17.22%100.00%0.5 (0.5)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_poised_shadows
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.20
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 84.2s
  • trigger_min/max:2.0s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.2s
  • uptime_min/max:8.60% / 26.38%

Stack Uptimes

  • poised_shadows_1:17.22%

Spelldata

  • id:455573
  • name:Poised Shadows
  • tooltip:The damage of your next Secret Technique is increased by {$=}w1%.
  • description:{$@spelldesc453716=Symbols of Death increases the damage of your next Secret Technique by {$455573s1=20}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Premeditation17.20.017.9s18.9s1.1s2.61%11.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_premeditation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 68.9s
  • trigger_min/max:1.0s / 68.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 3.3s
  • uptime_min/max:0.77% / 4.98%

Stack Uptimes

  • premeditation_1:2.61%

Spelldata

  • id:343173
  • name:Premeditation
  • tooltip:Your next combo point generating ability generates full combo points.
  • description:{$@spelldesc343160=After entering Stealth, your next combo point generating ability generates full combo points.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Realigning Nexus Convergence Divergence1.20.0129.8s110.6s3.9s1.52%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_realigning_nexus_convergence_divergence
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 279.4s
  • trigger_min/max:90.0s / 189.4s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 10.2s
  • uptime_min/max:0.00% / 7.35%

Stack Uptimes

  • realigning_nexus_convergence_divergence_1:1.52%

Spelldata

  • id:449947
  • name:Realigning Nexus Convergence Divergence
  • tooltip:The voices seem to want you to jump! {$u=3} times should do it.
  • description:{$@spelldesc446209=}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.10.283.6s72.0s15.4s10.69%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:23922.58

Trigger Details

  • interval_min/max:15.0s / 322.3s
  • trigger_min/max:0.9s / 322.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.5s
  • uptime_min/max:0.00% / 35.92%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:10.69%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades3.60.090.8s90.8s15.8s19.18%17.15%0.0 (0.0)3.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 97.5s
  • trigger_min/max:90.0s / 97.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 16.0s
  • uptime_min/max:16.95% / 21.85%

Stack Uptimes

  • shadow_blades_1:19.18%

Spelldata

  • id:121471
  • name:Shadow Blades
  • tooltip:Attacks deal {$=}w1% additional damage as Shadow and combo point generating attacks generate full combo points.
  • description:Draws upon surrounding shadows to empower your weapons, causing your attacks to deal {$s1=20}% additional damage as Shadow and causing your combo point generating abilities to generate full combo points for {$d=16 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:90.00
  • default_chance:100.00%
Shadow Dance13.30.023.1s23.1s8.2s36.46%100.00%0.0 (0.0)12.9

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.30
  • auto_attack:1.30
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:8.0s / 73.2s
  • trigger_min/max:8.0s / 73.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:33.39% / 39.38%

Stack Uptimes

  • shadow_dance_1:36.46%

Spelldata

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=6 seconds}{$?a245687=true}[, and increases damage by {$s2=0}%][]. Effect not broken from taking damage or attacking.
  • max_stacks:0
  • duration:6.00
  • cooldown:6.00
  • default_chance:0.00%
Shadow Techniques67.9137.84.4s1.4s3.5s79.10%95.40%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shadow_techniques
  • max_stacks:14
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.45
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 41.8s
  • trigger_min/max:0.5s / 6.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.9s
  • uptime_min/max:71.33% / 86.52%

Stack Uptimes

  • shadow_techniques_1:20.44%
  • shadow_techniques_2:20.98%
  • shadow_techniques_3:9.41%
  • shadow_techniques_4:10.44%
  • shadow_techniques_5:6.04%
  • shadow_techniques_6:5.85%
  • shadow_techniques_7:2.59%
  • shadow_techniques_8:2.33%
  • shadow_techniques_9:0.52%
  • shadow_techniques_10:0.44%
  • shadow_techniques_11:0.03%
  • shadow_techniques_12:0.03%
  • shadow_techniques_13:0.00%
  • shadow_techniques_14:0.00%

Spelldata

  • id:196911
  • name:Shadow Techniques
  • tooltip:Combo points stored.
  • description:{$@spelldesc196912=Your auto attacks have a {$s2=28}% chance to generate {$196911s2=4} Energy and store {$m1=1} combo {$=}Lpoint:points;, up to {$196911u=10}. Attacks that generate combo points can expend those stored to generate additional combo points, up to your maximum.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Slice and Dice1.00.00.0s0.0s296.8s99.32%87.63%98.4 (98.4)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:238.1s / 357.9s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • slice_and_dice_1:99.32%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Storm Sewer's Citrine0.50.0100.6s93.2s10.0s1.54%0.00%0.0 (0.0)0.5

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:9.0s / 295.5s
  • trigger_min/max:2.0s / 295.5s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 19.8s
  • uptime_min/max:0.00% / 12.23%

Stack Uptimes

  • storm_sewers_citrine_1:1.54%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0113.5s102.8s9.9s1.41%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:3.0s / 295.7s
  • trigger_min/max:2.0s / 272.2s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 17.2s
  • uptime_min/max:0.00% / 18.13%

Stack Uptimes

  • storm_sewers_citrine_1:1.41%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.40.0115.8s106.6s9.9s1.45%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:14.1s / 295.2s
  • trigger_min/max:2.7s / 281.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.1s
  • uptime_min/max:0.00% / 11.17%

Stack Uptimes

  • storm_sewers_citrine_1:1.45%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Sewer's Citrine0.50.0107.1s93.3s10.0s1.51%0.00%0.0 (0.0)0.4

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.1s / 319.1s
  • trigger_min/max:1.0s / 295.5s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 19.2s
  • uptime_min/max:0.00% / 12.68%

Stack Uptimes

  • storm_sewers_citrine_1:1.51%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)}][{$=}{{$462342s3=10779}*({$s2=2941}/100)}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.10.281.8s70.3s15.3s10.73%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1374.86
  • stat:haste_rating
  • amount:1374.86
  • stat:mastery_rating
  • amount:1374.86
  • stat:versatility_rating
  • amount:1374.86

Trigger Details

  • interval_min/max:15.1s / 337.1s
  • trigger_min/max:1.0s / 337.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.1s
  • uptime_min/max:0.00% / 40.75%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:10.73%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Supercharge (_1)14.20.021.3s21.3s2.3s10.99%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_1
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 71.5s
  • trigger_min/max:3.0s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.1s
  • uptime_min/max:9.30% / 14.13%

Stack Uptimes

  • supercharge_1_1:10.99%

Spelldata

  • id:470398
  • name:Supercharge
  • tooltip:Rogue's first combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_2)14.20.021.3s21.3s1.0s2.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_2
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 71.5s
  • trigger_min/max:2.0s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.9s
  • uptime_min/max:0.30% / 5.32%

Stack Uptimes

  • supercharge_2_1:2.03%

Spelldata

  • id:470406
  • name:Supercharge
  • tooltip:Rogue's second combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_3)0.00.00.0s0.0s2.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_3
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.0s / 2.0s
  • uptime_min/max:0.00% / 0.69%

Stack Uptimes

  • supercharge_3_1:0.00%

Spelldata

  • id:470409
  • name:Supercharge
  • tooltip:Rogue's third combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Supercharge (_4)0.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_supercharge_4
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:470412
  • name:Supercharge
  • tooltip:Rogue's fourth combo point is supercharged. Damaging finishing moves consume a supercharged combo point to function as if they spent {$470347s2=2} additional combo points.
  • description:{$@spelldesc470347={$?a137035=true}[Symbols of Death]?a137036[Roll the Bones][Shiv] supercharges {$m1=1} combo {$=}Lpoint:points;. Damaging finishing moves consume a supercharged combo point to function as if they spent {$m2=2} additional combo {$=}Lpoint:points;.}
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Symbols of Death7.46.843.5s21.3s24.5s61.16%100.00%6.8 (6.8)6.8

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.16
  • periodic:1.16
  • auto_attack:1.16
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:12.2s / 97.2s
  • trigger_min/max:2.0s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s
  • uptime_min/max:56.30% / 65.13%

Stack Uptimes

  • symbols_of_death_1:61.16%

Spelldata

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Invoke ancient symbols of power, generating {$s6=40} Energy and increasing damage done by {$s1=10}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.50
  • default_chance:0.00%
Tempered Potion1.50.0308.1s308.1s27.8s13.29%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.5s
  • trigger_min/max:300.0s / 329.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.0s
  • uptime_min/max:9.97% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.29%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
The First Dance1.00.00.0s0.0s5.0s1.70%3.81%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_the_first_dance
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 5.0s
  • uptime_min/max:1.39% / 2.09%

Stack Uptimes

  • the_first_dance_1:1.70%

Spelldata

  • id:470678
  • name:The First Dance
  • tooltip:The duration of your next Shadow Dance is increased by {$=}{{$s1=4000}/1000} sec.
  • description:{$@spelldesc382505=Remaining out of combat for {$470677d=6 seconds} increases the duration of your next Shadow Dance by {$=}{{$470678s1=4000}/1000} sec.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
The Rotten14.20.021.3s21.3s2.9s13.79%22.30%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_the_rotten
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.35
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:3.0s / 71.5s
  • trigger_min/max:2.0s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:11.16% / 16.28%

Stack Uptimes

  • the_rotten_1:10.74%
  • the_rotten_2:3.05%

Spelldata

  • id:394203
  • name:The Rotten
  • tooltip:Your next attack that generates combo points deals {$s3=35}% increased damage and is guaranteed to critically strike.
  • description:{$@spelldesc382015=After activating Symbols of Death, your next {$@=}switch<{$s1=2}>[attack][{$s1=2} attacks] that {$@=}switch<{$s1=2}>[generates][generate] combo points {$@=}switch<{$s1=2}>[deals][deal] {$394203s3=35}% increased damage and {$@=}switch<{$s1=2}>[is][are] guaranteed to critically strike.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vanish2.90.0122.4s122.4s0.1s0.08%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.6s
  • trigger_min/max:120.0s / 136.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.5s
  • uptime_min/max:0.00% / 0.36%

Stack Uptimes

  • vanish_1:0.08%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)0.10.057.4s30.1s15.2s0.47%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4722.12

Trigger Details

  • interval_min/max:20.0s / 120.8s
  • trigger_min/max:1.2s / 120.8s
  • trigger_pct:100.00%
  • duration_min/max:5.8s / 28.3s
  • uptime_min/max:0.00% / 15.00%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:0.54%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (_Vers_proc)2.10.282.2s69.5s15.4s10.66%0.00%0.2 (0.2)2.0

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_windsingers_runed_citrine_Vers
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:5499.44

Trigger Details

  • interval_min/max:15.0s / 316.1s
  • trigger_min/max:1.0s / 316.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.3s
  • uptime_min/max:0.00% / 36.33%

Stack Uptimes

  • windsingers_runed_citrine_Vers_1:10.66%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.19

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shot in the Dark

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_shot_in_the_dark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257506
  • name:Shot in the Dark
  • tooltip:Your next Cheap Shot is free.
  • description:{$@spelldesc257505=After entering Stealth or Shadow Dance, your next Cheap Shot is free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)48.827.077.06.0s0.7s62.1s
Skyfury (Off Hand)49.225.073.06.0s0.7s65.2s
Supercharger secret_technique12.48.016.023.6s9.2s90.1s
Cold Blood secret_technique3.53.04.090.6s82.8s100.2s
Supercharger rupture0.30.02.0167.9s45.8s272.1s
Supercharger coup_de_grace2.80.09.075.4s9.2s328.4s
Supercharger eviscerate12.97.020.023.2s1.0s129.2s
CP Spent During Flagellation201.4141.0251.011.1s1.0s89.1s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap9.37%6.40%13.58%0.7s0.0s1.9s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Equipped
Energy RegenEnergy1,433.143,025.1034.11%2.11396.4011.59%
Improved AmbushCombo Points52.2233.464.59%0.6418.7635.93%
PremeditationCombo Points17.1756.907.80%3.3163.2952.66%
Relentless StrikesEnergy107.064,260.3048.04%39.79124.072.83%
Shadow BladesCombo Points21.85113.4915.56%5.1917.6013.42%
Shadow TechniquesEnergy358.291,228.3913.85%3.43204.7714.29%
Shadow TechniquesCombo Points85.15239.3132.80%2.810.000.00%
Shadow Techniques (Shadowcraft)Combo Points15.34107.3914.72%7.000.000.00%
BackstabCombo Points75.0074.6310.23%1.000.370.49%
ShadowstrikeCombo Points52.22104.4014.31%2.000.040.04%
Symbols of DeathEnergy14.23354.644.00%24.92214.6737.71%
Usage Type Count Total Tot% Avg RPE APR
Equipped
BackstabEnergy75.003,000.0033.62%40.0040.003,010.40
Coup de GraceEnergy13.24463.335.19%35.0035.0182,371.21
Coup de GraceCombo Points13.2490.4412.46%6.836.83421,978.63
EviscerateEnergy68.362,392.7126.82%35.0035.0045,650.56
EviscerateCombo Points68.36465.8264.19%6.816.81234,489.31
RuptureEnergy9.49237.232.66%25.0025.00147,307.10
RuptureCombo Points9.4964.908.94%6.846.84538,435.58
Secret TechniqueEnergy15.97479.155.37%30.0030.00169,353.21
Secret TechniqueCombo Points15.97104.4914.40%6.546.54776,574.67
ShadowstrikeEnergy52.222,350.0326.34%45.0044.9914,938.14
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy100.029.6829.86939.146.00.3100.0
Combo Points0.02.442.43100.03.90.07.0

Statistics & Data Analysis

Fight Length
Equipped Fight Length
Count 1114
Mean 298.78
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Equipped Damage Per Second
Count 1114
Mean 1469763.33
Minimum 1337939.84
Maximum 1609847.95
Spread ( max - min ) 271908.11
Range [ ( max - min ) / 2 * 100% ] 9.25%
Standard Deviation 49855.3631
5th Percentile 1390437.39
95th Percentile 1551342.64
( 95th Percentile - 5th Percentile ) 160905.25
Mean Distribution
Standard Deviation 1493.7203
95.00% Confidence Interval ( 1466835.69 - 1472690.96 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4421
0.1 Scale Factor Error with Delta=300 21218147
0.05 Scale Factor Error with Delta=300 84872585
0.01 Scale Factor Error with Delta=300 2121814611
Priority Target DPS
Equipped Priority Target Damage Per Second
Count 1114
Mean 1469763.33
Minimum 1337939.84
Maximum 1609847.95
Spread ( max - min ) 271908.11
Range [ ( max - min ) / 2 * 100% ] 9.25%
Standard Deviation 49855.3631
5th Percentile 1390437.39
95th Percentile 1551342.64
( 95th Percentile - 5th Percentile ) 160905.25
Mean Distribution
Standard Deviation 1493.7203
95.00% Confidence Interval ( 1466835.69 - 1472690.96 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4421
0.1 Scale Factor Error with Delta=300 21218147
0.05 Scale Factor Error with Delta=300 84872585
0.01 Scale Factor Error with Delta=300 2121814611
DPS(e)
Equipped Damage Per Second (Effective)
Count 1114
Mean 1469763.33
Minimum 1337939.84
Maximum 1609847.95
Spread ( max - min ) 271908.11
Range [ ( max - min ) / 2 * 100% ] 9.25%
Damage
Equipped Damage
Count 1114
Mean 438646103.36
Minimum 345256586.96
Maximum 542743902.79
Spread ( max - min ) 197487315.83
Range [ ( max - min ) / 2 * 100% ] 22.51%
DTPS
Equipped Damage Taken Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Equipped Healing Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Equipped Healing Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Equipped Heal
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Equipped Healing Taken Per Second
Count 1114
Mean 3190.01
Minimum 0.00
Maximum 10525.98
Spread ( max - min ) 10525.98
Range [ ( max - min ) / 2 * 100% ] 164.98%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=priority_rotation,value=priority_rotation
3 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
4 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
5 0.00 stealth
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
Variables
0.00 variable,name=targets,value=spell_targets.shuriken_storm
0.00 variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
0.00 variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
0.00 variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
0.00 variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
0.00 variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
6 0.00 call_action_list,name=cds
Cooldowns
7 0.00 call_action_list,name=race
Racials
8 0.00 call_action_list,name=item
Items (Trinkets)
9 0.00 call_action_list,name=stealth_cds,if=!variable.stealth
Cooldowns for Stealth
A 0.00 call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
Finishing Rules
B 0.00 call_action_list,name=build
Combo Point Builder
C 0.00 call_action_list,name=fill,if=!variable.stealth
Filler, Spells used if you can use nothing else.
actions.build
# count action,conditions
0.00 shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
Combo Point Builder
0.00 shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
0.00 shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
D 52.22 shadowstrike
0.00 goremaws_bite,if=combo_points.deficit>=3
0.00 gloomblade
E 75.00 backstab
actions.cds
# count action,conditions
F 3.55 cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
Cooldowns
G 1.45 potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
H 14.23 symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
I 3.63 shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
0.00 thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
J 3.70 flagellation,if=combo_points>=5|fight_remains<=25
actions.finish
# count action,conditions
K 15.97 secret_technique,if=variable.secret
L 9.49 rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
Maintenance Finisher
0.00 rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
M 13.24 coup_de_grace,if=debuff.fazed.up
Direct Damage Finisher
0.00 black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
N 68.36 eviscerate
actions.item
# count action,conditions
O 3.71 use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
Trinket and Items
P 3.68 do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
0.00 use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.stealth_cds
# count action,conditions
Q 13.26 shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
Shadow Dance, Vanish, Shadowmeld
R 2.93 vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
0.00 shadowmeld,if=energy>=40&combo_points.deficit>=3

Sample Sequence

0245ODGJNRDLHQPDIKDNNDNDMHNDFKNENENNENEEHQNDKNDMDNEELENHQDNDKDMDNENEENEEHQNDKDNDMDELENEENEEENEENEOEJHQPKDINDMNDNELHQNDFKNDNDNENENEENEEMRDLEHQKDNDNDNDNEENEEKEEEMEEELEENEENEENEOEJHQPKDIMDNNDNELHQDFKNDNDNNEEMHQDKDNDNDNEENEELNEEEHQKDMDNDNDENENEEKRDNEELEEMEENEEENOEJHQPKDINDMDNNEHQNKDNDNNDNNEENEE

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre2priority_rotation
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre4trinket_sync_slot
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
Pre5stealth
[precombat]
Equipped 100.0/100 100% energy
0.0/7 0% CP
the_first_dance
0:00.000Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
stealth, premeditation, the_first_dance
0:00.000Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, stealth, premeditation, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Gpotion
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence
0:01.004Jflagellation
[cds]
Fluffy_Pillow 72.4/100 72% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(2), flawless_form, shadow_techniques, the_first_dance, realigning_nexus_convergence_divergence, tempered_potion
0:02.007Neviscerate
[finish]
Fluffy_Pillow 86.2/100 86% energy
7.0/7 100% CP
bloodlust, acrobatic_strikes(3), flawless_form, shadow_techniques, the_first_dance, flagellation_buff, realigning_nexus_convergence_divergence, tempered_potion
0:03.010Rvanish
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(7), alacrity, flawless_form, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:03.010Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, vanish, acrobatic_strikes(7), alacrity, flawless_form, premeditation, shadow_techniques(2), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:04.014Lrupture
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity, flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(8), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.018Hsymbols_of_death
[cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, acrobatic_strikes(10), alacrity(2), flawless_form, shadow_techniques(4), the_first_dance, flagellation_buff(15), deeper_daggers, realigning_nexus_convergence_divergence, tempered_potion
0:05.018Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(4), the_first_dance, the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.018Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, tempered_potion
0:05.018Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.024Ishadow_blades
[cds]
Equipped 85.2/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:06.024Ksecret_technique
[finish]
Fluffy_Pillow 85.2/100 85% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, supercharge_2, flawless_form, shadow_techniques(6), the_rotten, flagellation_buff(15), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:07.028Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes(2), flawless_form(2), shadow_techniques(6), the_rotten, flagellation_buff(25), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, tempered_potion
0:08.031Neviscerate
[finish]
Fluffy_Pillow 77.3/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), supercharge_1, disorienting_strikes, flawless_form(3), shadow_techniques(8), flagellation_buff(25), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:09.035Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:10.040Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(3), shadow_techniques(3), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:11.044Neviscerate
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(5), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:12.048Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(3), shadow_techniques(7), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, tempered_potion
0:13.052Mcoup_de_grace
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(4), shadow_techniques(9), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.256Hsymbols_of_death
[cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_persist(30), deeper_daggers, ethereal_powerlink, tempered_potion
0:14.256Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, tempered_potion
0:15.262Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(6), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:16.266Fcold_blood
[cds]
Equipped 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:16.266Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(9), shadow_techniques(8), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:17.270Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(10), shadow_techniques, the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:18.275Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:19.279Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Mastery, tempered_potion
0:20.284Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:21.288Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(9), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:22.292Neviscerate
[finish]
Fluffy_Pillow 97.2/100 97% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:23.297Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:24.302Neviscerate
[finish]
Fluffy_Pillow 82.6/100 83% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:25.307Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:26.311Ebackstab
[build]
Fluffy_Pillow 82.6/100 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:27.316Hsymbols_of_death
[cds]
Equipped 57.2/100 57% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, nascent_empowerment_Mastery, tempered_potion
0:27.316Qshadow_dance
[stealth_cds]
Equipped 97.2/100 97% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:27.316Neviscerate
[finish]
Fluffy_Pillow 97.2/100 97% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(4), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:28.319Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), premeditation, shadow_techniques(5), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:29.324Ksecret_technique
[finish]
Fluffy_Pillow 77.6/100 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(3), shadow_techniques(7), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Mastery, tempered_potion
0:30.329Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(2), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Mastery, tempered_potion
0:31.333Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:32.337Mcoup_de_grace
[finish]
Fluffy_Pillow 77.0/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:33.542Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(6), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:34.548Neviscerate
[finish]
Fluffy_Pillow 77.1/100 77% energy
7.0/7 100% CP
bloodlust, slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery
0:35.552Ebackstab
[build]
Fluffy_Pillow 91.1/100 91% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, bolstering_shadows
0:36.556Ebackstab
[build]
Fluffy_Pillow 73.1/100 73% energy
5.0/7 71% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers
0:37.561Lrupture
[finish]
Fluffy_Pillow 47.8/100 48% energy
7.0/7 100% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques, deeper_daggers, nascent_empowerment_Haste
0:38.565Ebackstab
[build]
Fluffy_Pillow 88.5/100 89% energy
0.0/7 0% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste
0:39.569Neviscerate
[finish]
Fluffy_Pillow 71.2/100 71% energy
6.0/7 86% CP
bloodlust, slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste
0:40.571Hsymbols_of_death
[cds]
Equipped 79.0/100 79% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(10), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste
0:40.571Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste
0:40.571Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(10), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste
0:41.576Neviscerate
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Haste
0:42.580Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(9), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste
0:43.584Ksecret_technique
[finish]
Fluffy_Pillow 82.3/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(3), flawless_form(8), shadow_techniques(6), deeper_daggers, poised_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste
0:44.589Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(3), flawless_form(4), shadow_techniques(6), deeper_daggers, poised_shadows, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:45.595Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
0:46.798Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:47.803Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(10), shadow_techniques(4), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:48.809Ebackstab
[build]
Fluffy_Pillow 92.7/100 93% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:49.811Neviscerate
[finish]
Fluffy_Pillow 71.5/100 72% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:50.816Ebackstab
[build]
Fluffy_Pillow 90.4/100 90% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(4), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:51.821Ebackstab
[build]
Fluffy_Pillow 69.2/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:52.827Neviscerate
[finish]
Fluffy_Pillow 40.1/100 40% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques, deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:53.831Ebackstab
[build]
Fluffy_Pillow 58.9/100 59% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(3), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:55.121Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(2), deeper_daggers, windsingers_runed_citrine_Vers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:56.682Hsymbols_of_death
[cds]
Equipped 25.7/100 26% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:56.682Qshadow_dance
[stealth_cds]
Equipped 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:56.682Neviscerate
[finish]
Fluffy_Pillow 65.7/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(6), premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:57.687Dshadowstrike
[build]
Fluffy_Pillow 91.5/100 92% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade, flawless_form, premeditation, shadow_techniques(2), the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:58.692Ksecret_technique
[finish]
Fluffy_Pillow 73.4/100 73% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
0:59.697Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form(2), shadow_techniques(6), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:00.701Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:01.707Dshadowstrike
[build]
Fluffy_Pillow 84.7/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:02.712Mcoup_de_grace
[finish]
Fluffy_Pillow 58.5/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:03.915Dshadowstrike
[build]
Fluffy_Pillow 96.5/100 97% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:04.920Ebackstab
[build]
Fluffy_Pillow 70.4/100 70% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:05.926Lrupture
[finish]
Fluffy_Pillow 49.2/100 49% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_crit
1:06.931Ebackstab
[build]
Fluffy_Pillow 78.1/100 78% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(5), deeper_daggers, flask_of_alchemical_chaos_crit
1:07.936Neviscerate
[finish]
Fluffy_Pillow 56.9/100 57% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:08.939Ebackstab
[build]
Fluffy_Pillow 62.8/100 63% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
1:09.943Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:13.016Neviscerate
[finish]
Fluffy_Pillow 39.5/100 40% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:14.020Ebackstab
[build]
Fluffy_Pillow 45.9/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:16.439Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:19.715Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, flawless_form, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:22.188Neviscerate
[finish]
Fluffy_Pillow 35.7/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(2), fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:23.194Ebackstab
[build]
Fluffy_Pillow 50.5/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques(3), deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:25.846Ebackstab
[build]
Fluffy_Pillow 43.0/100 43% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:28.470Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), escalating_blade, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:29.473Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:30.479Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 16.1/100 16% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:32.601Ebackstab
[build]
Fluffy_Pillow 43.1/100 43% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade, shadow_techniques(2), deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:33.604Jflagellation
[cds]
Fluffy_Pillow 14.0/100 14% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.608Hsymbols_of_death
[cds]
Equipped 28.9/100 29% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity, escalating_blade(2), flawless_form, shadow_techniques, flagellation_buff, deeper_daggers, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.608Qshadow_dance
[stealth_cds]
Equipped 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.608Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, errant_manaforge_emission, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:34.608Ksecret_technique
[finish]
Fluffy_Pillow 68.9/100 69% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity, supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:35.612Dshadowstrike
[build]
Fluffy_Pillow 97.9/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:36.618Ishadow_blades
[cds]
Equipped 71.9/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:36.618Neviscerate
[finish]
Fluffy_Pillow 71.9/100 72% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(2), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(9), bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:37.621Dshadowstrike
[build]
Fluffy_Pillow 98.0/100 98% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(5), the_rotten, flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:38.625Mcoup_de_grace
[finish]
Fluffy_Pillow 80.1/100 80% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(3), escalating_blade(4), flawless_form(4), shadow_techniques(9), flagellation_buff(19), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:39.830Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(4), flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:40.834Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:41.839Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:42.844Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:43.848Lrupture
[finish]
Fluffy_Pillow 63.4/100 63% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:44.852Hsymbols_of_death
[cds]
Equipped 92.2/100 92% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(3), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:45.019Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:45.019Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(3), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:46.025Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), premeditation, shadow_techniques(5), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:47.030Fcold_blood
[cds]
Equipped 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(7), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:47.030Ksecret_technique
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, flawless_form(7), shadow_techniques(7), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:48.034Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(2), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:49.039Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(7), shadow_techniques(4), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:50.044Neviscerate
[finish]
Fluffy_Pillow 65.8/100 66% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(7), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:51.049Dshadowstrike
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(2), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:52.054Neviscerate
[finish]
Fluffy_Pillow 50.4/100 50% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(6), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:53.058Ebackstab
[build]
Fluffy_Pillow 69.2/100 69% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:54.062Neviscerate
[finish]
Fluffy_Pillow 56.0/100 56% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(6), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:55.066Ebackstab
[build]
Fluffy_Pillow 74.8/100 75% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(8), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:56.071Neviscerate
[finish]
Fluffy_Pillow 45.6/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:57.075Ebackstab
[build]
Fluffy_Pillow 64.4/100 64% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
1:58.080Ebackstab
[build]
Fluffy_Pillow 43.2/100 43% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, nascent_empowerment_Vers, flask_of_alchemical_chaos_mastery
2:00.411Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_mastery
2:01.416Ebackstab
[build]
Fluffy_Pillow 51.5/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:03.742Ebackstab
[build]
Fluffy_Pillow 45.8/100 46% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:06.010Mcoup_de_grace
[finish]
Fluffy_Pillow 35.4/100 35% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:07.214Rvanish
[stealth_cds]
Equipped 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:07.214Dshadowstrike
[build]
Fluffy_Pillow 78.0/100 78% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), flawless_form(6), premeditation, shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:08.218Lrupture
[finish]
Fluffy_Pillow 44.3/100 44% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:09.221Ebackstab
[build]
Fluffy_Pillow 69.6/100 70% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(4), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:10.222Hsymbols_of_death
[cds]
Equipped 44.9/100 45% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:10.222Qshadow_dance
[stealth_cds]
Equipped 84.9/100 85% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:10.222Ksecret_technique
[finish]
Fluffy_Pillow 84.9/100 85% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(7), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:11.226Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:12.230Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:13.234Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(9), shadow_techniques(7), the_rotten, deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_mastery
2:14.240Neviscerate
[finish]
Fluffy_Pillow 74.3/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:15.245Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:16.250Neviscerate
[finish]
Fluffy_Pillow 60.1/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:17.256Dshadowstrike
[build]
Fluffy_Pillow 79.7/100 80% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(9), shadow_techniques(5), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:18.260Neviscerate
[finish]
Fluffy_Pillow 46.4/100 46% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:19.266Ebackstab
[build]
Fluffy_Pillow 66.0/100 66% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(3), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:20.558Ebackstab
[build]
Fluffy_Pillow 49.0/100 49% energy
4.0/7 57% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:22.199Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:23.205Ebackstab
[build]
Fluffy_Pillow 55.6/100 56% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:25.053Ebackstab
[build]
Fluffy_Pillow 41.0/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques, deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:27.687Ksecret_technique
[finish]
Fluffy_Pillow 31.5/100 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form, deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:28.691Ebackstab
[build]
Fluffy_Pillow 52.2/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(4), flawless_form(2), shadow_techniques, deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:30.763Ebackstab
[build]
Fluffy_Pillow 44.1/100 44% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques(2), bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:33.697Ebackstab
[build]
Fluffy_Pillow 41.6/100 42% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, bolstering_shadows, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:36.069Mcoup_de_grace
[finish]
Fluffy_Pillow 36.5/100 37% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(5), shadow_techniques(2), flask_of_alchemical_chaos_haste
2:37.273Ebackstab
[build]
Fluffy_Pillow 75.2/100 75% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:38.277Ebackstab
[build]
Fluffy_Pillow 50.6/100 51% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
2:40.656Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:42.093Lrupture
[finish]
Fluffy_Pillow 25.9/100 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
2:43.097Ebackstab
[build]
Fluffy_Pillow 51.9/100 52% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:45.277Ebackstab
[build]
Fluffy_Pillow 41.1/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:47.661Neviscerate
[finish]
Fluffy_Pillow 36.0/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(5), shadow_techniques(2), nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:48.666Ebackstab
[build]
Fluffy_Pillow 42.4/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:51.517Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:53.784Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:54.790Ebackstab
[build]
Fluffy_Pillow 42.5/100 42% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
2:57.460Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:00.263Neviscerate
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:01.266Ebackstab
[build]
Fluffy_Pillow 42.6/100 43% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_vers
3:02.270Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 17.8/100 18% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_vers
3:04.071Ebackstab
[build]
Fluffy_Pillow 41.2/100 41% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:05.077Jflagellation
[cds]
Fluffy_Pillow 12.0/100 12% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.081Hsymbols_of_death
[cds]
Equipped 26.8/100 27% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques, flagellation_buff, deeper_daggers, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.081Qshadow_dance
[stealth_cds]
Equipped 66.8/100 67% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.081Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 66.8/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, realigning_nexus_convergence_divergence, flask_of_alchemical_chaos_vers
3:06.081Ksecret_technique
[finish]
Fluffy_Pillow 66.8/100 67% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:07.087Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(3), premeditation, shadow_techniques, the_rotten(2), flagellation_buff(9), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.090Ishadow_blades
[cds]
Equipped 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:08.090Mcoup_de_grace
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(4), shadow_techniques(3), the_rotten, flagellation_buff(9), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:09.294Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(9), shadow_techniques(5), the_rotten, flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:10.299Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(7), flagellation_buff(24), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:11.304Neviscerate
[finish]
Fluffy_Pillow 92.6/100 93% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:12.309Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), flagellation_buff(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_vers
3:13.315Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:14.319Ebackstab
[build]
Fluffy_Pillow 84.6/100 85% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:15.324Lrupture
[finish]
Fluffy_Pillow 63.4/100 63% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(6), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:16.328Hsymbols_of_death
[cds]
Equipped 92.2/100 92% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(8), shadow_techniques(8), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:16.328Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:16.328Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), premeditation, shadow_techniques(8), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:17.335Fcold_blood
[cds]
Equipped 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:17.335Ksecret_technique
[finish]
Fluffy_Pillow 74.1/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), cold_blood, supercharge_1, supercharge_2, escalating_blade, flawless_form(8), shadow_techniques(10), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:18.340Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade, flawless_form(8), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:19.345Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade, flawless_form(7), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:20.350Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(3), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, ethereal_powerlink, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:21.355Dshadowstrike
[build]
Fluffy_Pillow 85.1/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(2), flawless_form(2), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:22.360Neviscerate
[finish]
Fluffy_Pillow 59.1/100 59% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:23.365Neviscerate
[finish]
Fluffy_Pillow 86.1/100 86% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:24.369Ebackstab
[build]
Fluffy_Pillow 97.1/100 97% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(4), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:25.375Ebackstab
[build]
Fluffy_Pillow 76.2/100 76% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:26.379Mcoup_de_grace
[finish]
Fluffy_Pillow 47.2/100 47% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:27.584Hsymbols_of_death
[cds]
Equipped 85.4/100 85% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques, flagellation_persist(30), deeper_daggers, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:27.584Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:27.584Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), premeditation, shadow_techniques, the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:28.589Ksecret_technique
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(9), shadow_techniques(3), the_rotten, flagellation_persist(30), deeper_daggers, poised_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:29.595Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), flawless_form(9), shadow_techniques(5), the_rotten, deeper_daggers, poised_shadows, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:30.601Neviscerate
[finish]
Fluffy_Pillow 74.0/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade, flawless_form(10), shadow_techniques(3), deeper_daggers, bolstering_shadows, stormbringers_runed_citrine_proc, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:31.605Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(3), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:32.610Neviscerate
[finish]
Fluffy_Pillow 73.8/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:33.615Dshadowstrike
[build]
Fluffy_Pillow 87.6/100 88% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:34.620Neviscerate
[finish]
Fluffy_Pillow 61.4/100 61% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:35.625Ebackstab
[build]
Fluffy_Pillow 80.2/100 80% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(4), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:36.631Ebackstab
[build]
Fluffy_Pillow 51.0/100 51% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), deeper_daggers, nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:38.119Neviscerate
[finish]
Fluffy_Pillow 35.0/100 35% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_crit
3:39.121Ebackstab
[build]
Fluffy_Pillow 48.8/100 49% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:40.657Ebackstab
[build]
Fluffy_Pillow 41.3/100 41% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(4), deeper_daggers, flask_of_alchemical_chaos_crit
3:42.392Lrupture
[finish]
Fluffy_Pillow 35.9/100 36% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(7), deeper_daggers, flask_of_alchemical_chaos_crit
3:43.396Neviscerate
[finish]
Fluffy_Pillow 56.7/100 57% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, deeper_daggers, flask_of_alchemical_chaos_crit
3:44.398Ebackstab
[build]
Fluffy_Pillow 67.6/100 68% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:45.544Ebackstab
[build]
Fluffy_Pillow 40.6/100 41% energy
1.0/7 14% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, deeper_daggers, flask_of_alchemical_chaos_haste
3:48.515Ebackstab
[build]
Fluffy_Pillow 42.4/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:49.842Hsymbols_of_death
[cds]
Equipped 17.4/100 17% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form, deeper_daggers, flask_of_alchemical_chaos_haste
3:50.019Qshadow_dance
[stealth_cds]
Equipped 63.4/100 63% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:50.019Ksecret_technique
[finish]
Fluffy_Pillow 63.4/100 63% energy
5.0/7 71% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(3), flawless_form, premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, flask_of_alchemical_chaos_haste
3:51.025Dshadowstrike
[build]
Fluffy_Pillow 84.9/100 85% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(3), flawless_form(2), premeditation, shadow_techniques, the_rotten(2), deeper_daggers, poised_shadows, bolstering_shadows, flask_of_alchemical_chaos_haste
3:52.029Mcoup_de_grace
[finish]
Fluffy_Pillow 51.3/100 51% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(4), flawless_form(3), shadow_techniques, the_rotten, bolstering_shadows, flask_of_alchemical_chaos_haste
3:53.233Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, flawless_form(8), shadow_techniques(3), the_rotten, deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:54.236Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
6.0/7 86% CP
slice_and_dice, danse_macabre(4), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:55.239Dshadowstrike
[build]
Fluffy_Pillow 88.8/100 89% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(9), shadow_techniques(4), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:56.243Neviscerate
[finish]
Fluffy_Pillow 63.2/100 63% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(10), shadow_techniques(2), deeper_daggers, bolstering_shadows, flask_of_alchemical_chaos_haste
3:57.249Dshadowstrike
[build]
Fluffy_Pillow 74.6/100 75% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:58.253Ebackstab
[build]
Fluffy_Pillow 49.0/100 49% energy
5.0/7 71% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(2), deeper_daggers, flask_of_alchemical_chaos_haste
3:59.357Neviscerate
[finish]
Fluffy_Pillow 37.7/100 38% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(5), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:00.361Ebackstab
[build]
Fluffy_Pillow 57.7/100 58% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(7), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:01.366Neviscerate
[finish]
Fluffy_Pillow 37.6/100 38% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:02.372Ebackstab
[build]
Fluffy_Pillow 49.6/100 50% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:04.373Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:06.470Ksecret_technique
[finish]
Fluffy_Pillow 34.4/100 34% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:07.475Rvanish
[stealth_cds]
Equipped 51.3/100 51% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:07.475Dshadowstrike
[build]
Fluffy_Pillow 51.3/100 51% energy
0.0/7 0% CP
slice_and_dice, vanish, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:09.306Neviscerate
[finish]
Fluffy_Pillow 36.1/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:10.310Ebackstab
[build]
Fluffy_Pillow 48.0/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(2), shadow_techniques(4), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:12.654Ebackstab
[build]
Fluffy_Pillow 43.9/100 44% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:14.670Lrupture
[finish]
Fluffy_Pillow 31.9/100 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:15.675Ebackstab
[build]
Fluffy_Pillow 57.9/100 58% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(3), shadow_techniques(3), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:17.215Ebackstab
[build]
Fluffy_Pillow 40.2/100 40% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques, deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
4:19.609Mcoup_de_grace
[finish]
Fluffy_Pillow 36.3/100 36% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(2), shadow_techniques(2), flask_of_alchemical_chaos_haste
4:20.813Ebackstab
[build]
Fluffy_Pillow 74.0/100 74% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques(3), deeper_daggers, flask_of_alchemical_chaos_haste
4:21.816Ebackstab
[build]
Fluffy_Pillow 49.4/100 49% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(7), shadow_techniques, deeper_daggers, flask_of_alchemical_chaos_haste
4:24.087Neviscerate
[finish]
Fluffy_Pillow 35.2/100 35% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), deeper_daggers, flask_of_alchemical_chaos_haste
4:25.090Ebackstab
[build]
Fluffy_Pillow 45.6/100 46% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), flawless_form(6), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:27.603Ebackstab
[build]
Fluffy_Pillow 42.1/100 42% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(7), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:30.658Ebackstab
[build]
Fluffy_Pillow 40.8/100 41% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade, flawless_form(6), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:33.070Neviscerate
[finish]
Fluffy_Pillow 36.2/100 36% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:34.072Ouse_item_treacherous_transmitter
[item]
Fluffy_Pillow 47.6/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, flask_of_alchemical_chaos_haste
4:34.072Ebackstab
[build]
Fluffy_Pillow 47.6/100 48% energy
0.0/7 0% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques(2), deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:36.274Jflagellation
[cds]
Fluffy_Pillow 36.6/100 37% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(2), shadow_techniques, deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.279Hsymbols_of_death
[cds]
Equipped 52.0/100 52% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form, shadow_techniques(2), flagellation_buff, deeper_daggers, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.279Qshadow_dance
[stealth_cds]
Equipped 92.0/100 92% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.279Pdo_treacherous_transmitter_task
[item]
Fluffy_Pillow 92.0/100 92% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, cryptic_instructions, flask_of_alchemical_chaos_haste
4:37.279Ksecret_technique
[finish]
Fluffy_Pillow 92.0/100 92% energy
3.0/7 43% CP
slice_and_dice, danse_macabre, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, escalating_blade(2), flawless_form, premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff, deeper_daggers, poised_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:38.284Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(2), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes(2), escalating_blade(2), flawless_form(2), premeditation, shadow_techniques(2), the_rotten(2), flagellation_buff(7), deeper_daggers, poised_shadows, bolstering_shadows, fathomdwellers_runed_citrine_proc, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.286Ishadow_blades
[cds]
Equipped 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(7), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:39.286Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(7), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:40.292Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade(3), flawless_form(3), shadow_techniques(4), the_rotten, flagellation_buff(17), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:41.296Mcoup_de_grace
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(4), flawless_form(4), shadow_techniques(6), flagellation_buff(17), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:42.500Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(9), shadow_techniques(8), flagellation_buff(29), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:43.505Neviscerate
[finish]
Fluffy_Pillow 82.4/100 82% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(12), flagellation_buff(29), deeper_daggers, bolstering_shadows, ethereal_powerlink, flask_of_alchemical_chaos_haste
4:44.511Neviscerate
[finish]
Fluffy_Pillow 93.6/100 94% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(5), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(5), flagellation_buff(30), deeper_daggers, ethereal_powerlink, flask_of_alchemical_chaos_crit
4:45.516Ebackstab
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(7), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:46.521Hsymbols_of_death
[cds]
Equipped 79.3/100 79% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), flawless_form(8), shadow_techniques(9), flagellation_buff(30), deeper_daggers, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:46.521Qshadow_dance
[stealth_cds]
Equipped 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), shadow_techniques(9), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:46.521Neviscerate
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre, shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, supercharge_2, flawless_form(8), premeditation, shadow_techniques(9), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:47.526Ksecret_technique
[finish]
Fluffy_Pillow 100.0/100 100% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(2), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), supercharge_1, flawless_form(8), premeditation, shadow_techniques(4), the_rotten(2), flagellation_buff(30), deeper_daggers, poised_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:48.530Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(3), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes(2), flawless_form(9), premeditation, shadow_techniques(4), the_rotten(2), flagellation_persist(30), deeper_daggers, poised_shadows, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:49.536Neviscerate
[finish]
Fluffy_Pillow 74.4/100 74% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(9), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:50.542Dshadowstrike
[build]
Fluffy_Pillow 85.7/100 86% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), disorienting_strikes, escalating_blade, flawless_form(8), shadow_techniques(6), the_rotten, flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:51.549Neviscerate
[finish]
Fluffy_Pillow 60.1/100 60% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(9), shadow_techniques(8), flagellation_persist(30), deeper_daggers, bolstering_shadows, ethereal_powerlink, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:52.553Neviscerate
[finish]
Fluffy_Pillow 87.4/100 87% energy
7.0/7 100% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(8), shadow_techniques(5), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:53.558Dshadowstrike
[build]
Fluffy_Pillow 100.0/100 100% energy
0.0/7 0% CP
slice_and_dice, danse_macabre(4), shadow_blades, shadow_dance, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(2), flawless_form(3), shadow_techniques(7), flagellation_persist(30), deeper_daggers, bolstering_shadows, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:54.562Neviscerate
[finish]
Fluffy_Pillow 66.3/100 66% energy
7.0/7 100% CP
slice_and_dice, shadow_blades, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(7), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:55.566Neviscerate
[finish]
Fluffy_Pillow 85.7/100 86% energy
7.0/7 100% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:56.571Ebackstab
[build]
Fluffy_Pillow 97.0/100 97% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:57.575Ebackstab
[build]
Fluffy_Pillow 76.3/100 76% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:58.581Neviscerate
[finish]
Fluffy_Pillow 47.7/100 48% energy
6.0/7 86% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(4), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
4:59.586Ebackstab
[build]
Fluffy_Pillow 62.0/100 62% energy
0.0/7 0% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(3), shadow_techniques(2), flagellation_persist(30), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
5:00.589Ebackstab
[build]
Fluffy_Pillow 41.4/100 41% energy
3.0/7 43% CP
slice_and_dice, symbols_of_death, acrobatic_strikes(10), alacrity(5), escalating_blade(3), flawless_form(2), shadow_techniques(2), deeper_daggers, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470577565651936181 (30583)
Stamina864520344962328536242084
Intellect12000012360120000
Spirit00000
Health689924065707200
Energy1001000
Combo Points770
Spell Power12360120000
Crit16.54%16.97%3476
Haste2.79%2.79%1843
Versatility29.74%22.21%17321
Attack Power6162857457938
Mastery64.97%54.02%9835
Armor263532635326353
Run Speed800
Leech3.48%3.48%488

Gear

Source Slot Average Item Level: 639.00
Local Head Circlet of the Enveloping Leviathan
ilevel: 639, stats: { 3,320 Armor, +24,202 Sta, +1,272 Vers, +752 Mastery, +3,794 AgiInt }, gems: { +181 StrAgiInt }
Local Neck Silken Advisor's Favor
ilevel: 639, stats: { +13,614 Sta, +5,079 Vers, +1,051 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 639, stats: { 3,043 Armor, +18,152 Sta, +989 Vers, +528 Mastery, +2,846 AgiInt }
Local Chest K'areshi Phantom's Nexus Wraps
ilevel: 639, stats: { 4,426 Armor, +24,202 Sta, +652 Crit, +1,371 Vers, +3,794 AgiInt }, enchant: { +745 StrAgiInt (crystalline_radiance_3) }
Local Waist Devourer's Taut Innards
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,057 Vers, +461 Mastery, +2,846 AgiInt }, gems: { +147 Mastery, +49 Vers }
Local Legs K'areshi Phantom's Leggings
ilevel: 639, stats: { 3,873 Armor, +24,202 Sta, +604 Crit, +1,419 Mastery, +3,794 AgiInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet K'areshi Phantom's Netherwalkers
ilevel: 639, stats: { 2,766 Armor, +18,152 Sta, +474 Vers, +1,044 Mastery, +2,846 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Rune-Branded Armbands
ilevel: 636, stats: { 2,173 Armor, +13,070 Sta, +561 Mastery, +561 Vers, +2,076 AgiInt }, gems: { +147 Mastery, +49 Vers }, enchant: { +1,090 Avoidance (chant_of_armored_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Hands K'areshi Phantom's Grips
ilevel: 639, stats: { 2,490 Armor, +18,152 Sta, +1,071 Crit, +447 Haste, +2,846 AgiInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Vers (radiant_versatility_3) }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Acidic Attendant's Loop
ilevel: 639, stats: { +13,614 Sta, +4,466 Vers, +1,664 Mastery }, gems: { +147 Mastery, +49 Vers, +147 Mastery, +49 Vers }, enchant: { +315 Vers (radiant_versatility_3) }
Local Trinket1 Treacherous Transmitter
ilevel: 626, stats: { +1,360 Haste }
item effects: { equip: Treacherous Transmitter, use: Cryptic Instructions }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 639, stats: { +3,607 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 639, stats: { 1,772 Armor, +13,614 Sta, +358 Crit, +781 Mastery, +2,134 StrAgiInt, +488 Leech }, enchant: { +545 Avoidance (chant_of_winged_grace_3) }
Local Main Hand Blood-Kissed Kukri
ilevel: 639, weapon: { 2,911 - 4,853, 1.8 }, stats: { +1,897 Agi, +12,101 Sta, +723 Crit, +289 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Everforged Stabber
ilevel: 636, weapon: { 2,831 - 4,719, 1.8 }, stats: { +1,845 Agi, +11,618 Sta, +499 Mastery, +499 Vers }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { equip: Elemental Focusing Lens }

Profile

rogue="Equipped"
source=default
spec=subtlety
level=80
race=human
role=attack
position=back
professions=leatherworking=100/alchemy=29
talents=CUQAA0tw2gAD7pPTLoW5IGZDeAAM2mBAAAAAgZZMWmGzYmxMzYMDzMjhxsNLGzstMzMmZmBMWmtBAAAgZwAYMbGGYgZRL0iNYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=priority_rotation,value=priority_rotation
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.is.treacherous_transmitter|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)
actions.precombat+=/stealth

# Executed every time the actor is available.
actions=stealth
# Variables
actions+=/variable,name=stealth,value=buff.shadow_dance.up|buff.stealth.up|buff.vanish.up
actions+=/variable,name=targets,value=spell_targets.shuriken_storm
actions+=/variable,name=skip_rupture,value=buff.shadow_dance.up|!buff.slice_and_dice.up|buff.darkest_night.up|variable.targets>=8&!talent.replicating_shadows&talent.unseen_blade
actions+=/variable,name=maintenance,value=(dot.rupture.ticking|variable.skip_rupture)&buff.slice_and_dice.up
actions+=/variable,name=secret,value=buff.shadow_dance.up|(cooldown.flagellation.remains<40&cooldown.flagellation.remains>20&talent.death_perception)
actions+=/variable,name=racial_sync,value=(buff.flagellation_buff.up&buff.shadow_dance.up)|!talent.shadow_blades&buff.symbols_of_death.up|fight_remains<20
actions+=/variable,name=shd_cp,value=combo_points<=1|buff.darkest_night.up&combo_points>=7|effective_combo_points>=6&talent.unseen_blade
# Cooldowns
actions+=/call_action_list,name=cds
# Racials
actions+=/call_action_list,name=race
# Items (Trinkets)
actions+=/call_action_list,name=item
# Cooldowns for Stealth
actions+=/call_action_list,name=stealth_cds,if=!variable.stealth
# Finishing Rules
actions+=/call_action_list,name=finish,if=!buff.darkest_night.up&effective_combo_points>=6|buff.darkest_night.up&combo_points==cp_max_spend
# Combo Point Builder
actions+=/call_action_list,name=build
# Filler, Spells used if you can use nothing else.
actions+=/call_action_list,name=fill,if=!variable.stealth

# Combo Point Builder
actions.build=shadowstrike,cycle_targets=1,if=debuff.find_weakness.remains<=2&variable.targets=2&talent.unseen_blade|!used_for_danse&!talent.premeditation
actions.build+=/shuriken_storm,if=talent.deathstalkers_mark&!buff.premeditation.up&variable.targets>=(2+3*buff.shadow_dance.up)|buff.clear_the_witnesses.up&!buff.symbols_of_death.up|buff.flawless_form.up&variable.targets>=3&!variable.stealth|talent.unseen_blade&buff.the_rotten.stack=1&variable.targets>=5&buff.shadow_dance.up
actions.build+=/shuriken_tornado,if=buff.lingering_darkness.up|talent.deathstalkers_mark&cooldown.shadow_blades.remains>=32&variable.targets>=2|talent.unseen_blade&buff.symbols_of_death.up&variable.targets>=4
actions.build+=/shadowstrike
actions.build+=/goremaws_bite,if=combo_points.deficit>=3
actions.build+=/gloomblade
actions.build+=/backstab

# Cooldowns
actions.cds=cold_blood,if=cooldown.secret_technique.up&buff.shadow_dance.up&combo_points>=6&variable.secret&buff.flagellation_persist.up
actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.flagellation_buff.up
actions.cds+=/symbols_of_death,if=(buff.symbols_of_death.remains<=3&variable.maintenance&(buff.flagellation_buff.up&cooldown.secret_technique.remains<8|!talent.flagellation|buff.flagellation_persist.up&talent.unseen_blade|cooldown.flagellation.remains>=30-15*!talent.death_perception&cooldown.secret_technique.remains<8|!talent.death_perception)|fight_remains<=15)
actions.cds+=/shadow_blades,if=variable.maintenance&variable.shd_cp&buff.shadow_dance.up&!buff.premeditation.up
actions.cds+=/thistle_tea,if=buff.shadow_dance.remains>2&!buff.thistle_tea.up
actions.cds+=/flagellation,if=combo_points>=5|fight_remains<=25

# This list usually contains Cooldowns with neglectable impact that causes global cooldowns
actions.fill=arcane_torrent,if=energy.deficit>=15+energy.regen
actions.fill+=/arcane_pulse
actions.fill+=/lights_judgment
actions.fill+=/bag_of_tricks

actions.finish=secret_technique,if=variable.secret
# Maintenance Finisher
actions.finish+=/rupture,if=!variable.skip_rupture&(!dot.rupture.ticking|refreshable)&target.time_to_die-remains>6
actions.finish+=/rupture,cycle_targets=1,if=!variable.skip_rupture&!variable.priority_rotation&&target.time_to_die>=(2*combo_points)&refreshable&variable.targets>=2
# Direct Damage Finisher
actions.finish+=/coup_de_grace,if=debuff.fazed.up
actions.finish+=/black_powder,if=!variable.priority_rotation&variable.maintenance&variable.targets>=2+3*buff.flawless_form.up&!buff.darkest_night.up
actions.finish+=/eviscerate

# Trinket and Items
actions.item=use_item,name=treacherous_transmitter,if=cooldown.flagellation.remains<=2|fight_remains<=15
actions.item+=/do_treacherous_transmitter_task,if=buff.shadow_dance.up|fight_remains<=15
actions.item+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=dot.rupture.ticking&buff.flagellation_buff.up
actions.item+=/use_item,name=mad_queens_mandate,if=(!talent.lingering_darkness|buff.lingering_darkness.up|equipped.treacherous_transmitter)&(!equipped.treacherous_transmitter|trinket.treacherous_transmitter.cooldown.remains>20)|fight_remains<=15
actions.item+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)
actions.item+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.shadow_blades.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&!buff.shadow_blades.up&cooldown.shadow_blades.remains>20))|!variable.trinket_sync_slot)

# Race Cooldowns
actions.race=blood_fury,if=variable.racial_sync
actions.race+=/berserking,if=variable.racial_sync
actions.race+=/fireblood,if=variable.racial_sync&buff.shadow_dance.up
actions.race+=/ancestral_call,if=variable.racial_sync
actions.race+=/invoke_external_buff,name=power_infusion,if=buff.shadow_dance.up

# Shadow Dance, Vanish, Shadowmeld
actions.stealth_cds=shadow_dance,if=variable.shd_cp&variable.maintenance&cooldown.secret_technique.remains<=24&(buff.symbols_of_death.remains>=6|buff.flagellation_persist.remains>=6)|fight_remains<=10
actions.stealth_cds+=/vanish,if=energy>=40&!buff.subterfuge.up&effective_combo_points<=3
actions.stealth_cds+=/shadowmeld,if=energy>=40&combo_points.deficit>=3

head=circlet_of_the_enveloping_leviathan,id=231824,bonus_id=10390/6652/10377/10383/10397/10299/3131/10255,gem_id=213743
neck=silken_advisors_favor,id=225575,bonus_id=6652/10356/10879/10396/10299/1540/10255,gem_id=213497/213497
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10356/10369/6652/10299/1540/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=41/10380/10356/10299/1540/10255,enchant_id=7403
chest=kareshi_phantoms_nexus_wraps,id=212041,bonus_id=10390/43/10299/10373/1540,enchant_id=7364
wrists=runebranded_armbands,id=219334,bonus_id=10421/9633/8902/9627/11144/10520/8960/8794/10222/11307,gem_id=213497,enchant_id=7385
hands=kareshi_phantoms_grips,id=212039,bonus_id=10372/10390/6652/10299/1540/10255
waist=devourers_taut_innards,id=212425,bonus_id=6652/10380/10356/10299/1540/10255/10397,gem_id=213497
legs=kareshi_phantoms_leggings,id=212037,bonus_id=6652/10356/8095/10370/10299/1540/10255,enchant_id=7601
feet=kareshi_phantoms_netherwalkers,id=212040,bonus_id=6652/10299/10356/8095/1540,enchant_id=7424
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228646,enchant_id=7352
finger2=acidic_attendants_loop,id=225728,bonus_id=6652/10356/10299/3288/10255/10394/10879,gem_id=213497/213497,enchant_id=7352
trinket1=treacherous_transmitter,id=221023,bonus_id=6652/10355/10256/1527/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10390/6652/10383/10299/3131/10255
main_hand=bloodkissed_kukri,id=212395,bonus_id=6652/10356/10299/1540/10255,enchant_id=7460
off_hand=everforged_stabber,id=222438,bonus_id=10421/9633/8902/9627/8794/10222/11144/10520/8960,enchant_id=7460

# Gear Summary
# gear_ilvl=639.00
# gear_agility=36181
# gear_stamina=242084
# gear_attack_power=938
# gear_crit_rating=3408
# gear_haste_rating=1807
# gear_mastery_rating=9642
# gear_versatility_rating=16981
# gear_leech_rating=488
# gear_avoidance_rating=1635
# gear_armor=26353
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 1126
Threads: 12
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 298.8 )

Performance:

Total Events Processed: 19948875
Max Event Queue: 595
Sim Seconds: 336422
CPU Seconds: 47.2969
Physical Seconds: 4.5670
Speed Up: 7113

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Combo 1 Combo 1 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 1 Combo 1 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.60sec 0 298.78sec
Combo 1 Combo 1 auto_attack_mh 0 14028758 46954 70.98 38398 77557 353.4 353.4 19.4% 16.4% 0.0% 0.0% 0.98sec 18301206 298.78sec
Combo 1 Combo 1 auto_attack_oh 1 6985719 23381 70.85 19121 38611 352.8 352.8 19.4% 16.2% 0.0% 0.0% 0.98sec 9113007 298.78sec
Combo 1 Combo 1 backstab 53 9054044 30304 15.09 72990 188547 75.1 75.1 41.1% 0.0% 0.0% 0.0% 3.68sec 11843965 298.78sec
Combo 1 Combo 1 cold_blood 382245 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 90.49sec 0 298.78sec
Combo 1 Combo 1 coup_de_grace 441776 26781143 89636 7.98 518538 1050693 13.3 39.7 29.3% 0.0% 0.0% 0.0% 22.25sec 34866912 298.78sec
Combo 1 Combo 1 eviscerate_coup_de_grace_bonus 462244 11438705 38285 7.69 230279 464533 0.0 38.3 29.3% 0.0% 0.0% 0.0% 0.00sec 11438705 298.78sec
Combo 1 Combo 1 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.72sec 0 298.78sec
Combo 1 Combo 1 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 1 Combo 1 elemental_focusing_lens_onyx 461191 5962983 19958 4.44 269765 0 22.1 22.1 0.0% 0.0% 0.0% 0.0% 12.96sec 5962983 298.78sec
Combo 1 Combo 1 eviscerate 196819 76750846 256884 13.74 858431 1758930 68.4 68.4 29.2% 0.0% 0.0% 0.0% 4.35sec 99837255 298.78sec
Combo 1 Combo 1 eviscerate_bonus 328082 32937182 110240 13.49 377661 768869 67.2 67.2 28.8% 0.0% 0.0% 0.0% 4.43sec 32937182 298.78sec
Combo 1 Combo 1 flagellation 384631 306354 1025 0.74 69672 139641 3.7 3.7 19.0% 0.0% 0.0% 0.0% 91.18sec 306354 298.78sec
Combo 1 Combo 1 flagellation_damage 394757 5982060 20022 4.77 209715 419266 0.0 23.8 20.1% 0.0% 0.0% 0.0% 0.00sec 5982060 298.78sec
Combo 1 Combo 1 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 1 Combo 1 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 1 Combo 1 instant_poison 315585 3653162 12227 56.78 10795 21773 0.0 282.7 19.4% 0.0% 0.0% 0.0% 0.00sec 3653162 298.78sec
Combo 1 Combo 1 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.4 0.0 0.0% 0.0% 0.0% 0.0% 11.54sec 0 298.78sec
Combo 1 Combo 1 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 67.99sec 0 298.78sec
Combo 1 Combo 1 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 69.13sec 0 298.78sec
Combo 1 Combo 1 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.47sec 0 298.78sec
Combo 1 Combo 1 recuperator 426605 0 0 0.00 0 0 98.4 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 298.78sec
Combo 1 Combo 1 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 67.40sec 0 298.78sec
Combo 1 Combo 1 rupture ticks -1943 29500148 98334 33.34 135733 282039 9.5 166.7 28.2% 0.0% 0.0% 0.0% 31.41sec 29500148 298.78sec
Combo 1 Combo 1 rupture_replicating_shadows ticks -394031 5427944 18093 0.00 24977 51818 166.7 0.0 28.3% 0.0% 0.0% 0.0% 1.76sec 5427944 298.78sec
Combo 1 Combo 1 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.90sec 0 298.78sec
Combo 1 Combo 1 secret_technique_player 280720 20788776 69580 3.21 683755 2124001 0.0 16.0 42.9% 0.0% 0.0% 0.0% 0.00sec 27097614 298.78sec
Combo 1 Combo 1 secret_technique_clones 282449 60388111 202118 6.40 994444 3027645 0.0 31.9 44.3% 0.0% 0.0% 0.0% 0.00sec 60388111 298.78sec
Combo 1 Combo 1 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.70sec 0 298.78sec
Combo 1 Combo 1 shadow_blades_attack ticks -279043 31332966 104443 0.00 81587 0 384.1 0.0 0.0% 0.0% 0.0% 0.0% 1.18sec 31332966 298.78sec
Combo 1 Combo 1 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.08sec 0 298.78sec
Combo 1 Combo 1 shadowstrike 185438 35226889 117904 10.49 280242 915996 52.2 52.2 62.0% 0.0% 0.0% 0.0% 5.79sec 45929738 298.78sec
Combo 1 Combo 1 squall_sailors_citrine 462952 1072556 3590 0.45 400698 807503 2.3 2.3 18.6% 0.0% 0.0% 0.0% 72.63sec 1072556 298.78sec
Combo 1 Combo 1 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 1 Combo 1 storm_sewers_citrine 462958 0 0 0.46 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 73.45sec 1588827 298.78sec
Combo 1 Combo 1 storm_sewers_citrine_damage 468422 253590 849 0.46 91804 183745 2.3 2.3 19.3% 0.0% 0.0% 0.0% 73.45sec 253590 298.78sec
Combo 1 Combo 1 suffocating_darkness ticks -449217 14064919 46883 21.36 131630 0 19.0 106.8 0.0% 0.0% 0.0% 0.0% 15.01sec 14064919 298.78sec
Combo 1 Combo 1 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.27sec 0 298.78sec
Combo 1 Combo 1 thunderlords_crackling_citrine 462951 20449493 68444 6.90 498156 997830 34.4 34.4 19.3% 0.0% 0.0% 0.0% 8.49sec 20449493 298.78sec
Combo 1 Combo 1 undersea_overseers_citrine 462953 1331496 4456 0.47 481506 965384 2.3 2.3 19.3% 0.0% 0.0% 0.0% 73.60sec 1331496 298.78sec
Combo 1 Combo 1 unseen_blade 441144 25500896 85351 11.65 367685 741593 58.0 58.0 19.3% 0.0% 0.0% 0.0% 5.14sec 33308308 298.78sec
Combo 1 Combo 1 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.60sec 0 298.78sec
Combo 1 Combo 1 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 71.45sec 0 298.78sec
Combo 2 Combo 2 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 2 Combo 2 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.66sec 0 298.78sec
Combo 2 Combo 2 auto_attack_mh 0 14088446 47154 72.07 38156 76911 358.9 358.9 18.8% 16.3% 0.0% 0.0% 0.97sec 18382493 298.78sec
Combo 2 Combo 2 auto_attack_oh 1 6998002 23422 72.01 18999 38251 358.6 358.6 18.8% 16.3% 0.0% 0.0% 0.97sec 9131253 298.78sec
Combo 2 Combo 2 backstab 53 9056655 30312 15.22 72659 188200 75.8 75.8 40.5% 0.0% 0.0% 0.0% 3.65sec 11849973 298.78sec
Combo 2 Combo 2 cold_blood 382245 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 90.73sec 0 298.78sec
Combo 2 Combo 2 coup_de_grace 441776 26530778 88798 8.01 515965 1031281 13.3 39.9 29.0% 0.0% 0.0% 0.0% 22.16sec 34540860 298.78sec
Combo 2 Combo 2 eviscerate_coup_de_grace_bonus 462244 11336298 37942 7.71 228528 459634 0.0 38.4 28.9% 0.0% 0.0% 0.0% 0.00sec 11336298 298.78sec
Combo 2 Combo 2 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.19sec 0 298.78sec
Combo 2 Combo 2 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 2 Combo 2 elemental_focusing_lens_onyx 461191 5915168 19798 4.42 268838 0 22.0 22.0 0.0% 0.0% 0.0% 0.0% 13.19sec 5915168 298.78sec
Combo 2 Combo 2 eviscerate 196819 75719452 253432 13.90 842096 1732462 69.2 69.2 28.4% 0.0% 0.0% 0.0% 4.30sec 98497793 298.78sec
Combo 2 Combo 2 eviscerate_bonus 328082 32591993 109085 13.64 370387 758032 67.9 67.9 28.3% 0.0% 0.0% 0.0% 4.38sec 32591993 298.78sec
Combo 2 Combo 2 flagellation 384631 300559 1006 0.74 68880 136797 3.7 3.7 18.6% 0.0% 0.0% 0.0% 91.39sec 300559 298.78sec
Combo 2 Combo 2 flagellation_damage 394757 5912388 19789 4.80 207652 416286 0.0 23.9 19.1% 0.0% 0.0% 0.0% 0.00sec 5912388 298.78sec
Combo 2 Combo 2 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 2 Combo 2 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 2 Combo 2 instant_poison 315585 3648713 12212 57.39 10721 21567 0.0 285.8 18.9% 0.0% 0.0% 0.0% 0.00sec 3648713 298.78sec
Combo 2 Combo 2 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.7 0.0 0.0% 0.0% 0.0% 0.0% 11.23sec 0 298.78sec
Combo 2 Combo 2 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 72.75sec 0 298.78sec
Combo 2 Combo 2 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 63.55sec 0 298.78sec
Combo 2 Combo 2 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.53sec 0 298.78sec
Combo 2 Combo 2 recuperator 426605 0 0 0.00 0 0 98.4 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 298.78sec
Combo 2 Combo 2 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 65.98sec 0 298.78sec
Combo 2 Combo 2 rupture ticks -1943 29430613 98102 33.84 134057 277420 9.5 169.2 27.8% 0.0% 0.0% 0.0% 31.46sec 29430613 298.78sec
Combo 2 Combo 2 rupture_replicating_shadows ticks -394031 5408843 18029 0.00 24640 50999 169.2 0.0 27.8% 0.0% 0.0% 0.0% 1.74sec 5408843 298.78sec
Combo 2 Combo 2 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.81sec 0 298.78sec
Combo 2 Combo 2 secret_technique_player 280720 20514963 68663 3.22 669483 2085547 0.0 16.0 43.1% 0.0% 0.0% 0.0% 0.00sec 26750100 298.78sec
Combo 2 Combo 2 secret_technique_clones 282449 59463686 199024 6.43 971372 2995014 0.0 32.0 43.8% 0.0% 0.0% 0.0% 0.00sec 59463686 298.78sec
Combo 2 Combo 2 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.86sec 0 298.78sec
Combo 2 Combo 2 shadow_blades_attack ticks -279043 30883447 102945 0.00 79593 0 388.0 0.0 0.0% 0.0% 0.0% 0.0% 1.17sec 30883447 298.78sec
Combo 2 Combo 2 shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.04sec 0 298.78sec
Combo 2 Combo 2 shadowstrike 185438 34791465 116447 10.49 278011 909513 52.2 52.2 61.5% 0.0% 0.0% 0.0% 5.78sec 45369937 298.78sec
Combo 2 Combo 2 spiderfling 452227 0 0 0.00 0 0 11.0 0.0 0.0% 0.0% 0.0% 0.0% 20.17sec 0 298.78sec
Combo 2 Combo 2 spidersting ticks -452229 2225247 7417 17.42 21621 43118 11.0 87.1 18.4% 0.0% 0.0% 0.0% 20.17sec 2225247 298.78sec
Combo 2 Combo 2 squall_sailors_citrine 462952 1110064 3715 0.47 397884 797009 2.4 2.4 18.3% 0.0% 0.0% 0.0% 67.64sec 1110064 298.78sec
Combo 2 Combo 2 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 2 Combo 2 storm_sewers_citrine 462958 0 0 0.45 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 74.49sec 1537134 298.78sec
Combo 2 Combo 2 storm_sewers_citrine_damage 468422 244328 818 0.45 90522 182661 2.3 2.3 19.3% 0.0% 0.0% 0.0% 74.49sec 244328 298.78sec
Combo 2 Combo 2 suffocating_darkness ticks -449217 14292886 47643 21.57 132475 0 19.4 107.8 0.0% 0.0% 0.0% 0.0% 14.49sec 14292886 298.78sec
Combo 2 Combo 2 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.27sec 0 298.78sec
Combo 2 Combo 2 thunderlords_crackling_citrine 462951 20539502 68745 7.02 494649 991085 35.0 35.0 18.7% 0.0% 0.0% 0.0% 8.35sec 20539502 298.78sec
Combo 2 Combo 2 undersea_overseers_citrine 462953 1333064 4462 0.47 477419 956309 2.3 2.3 19.6% 0.0% 0.0% 0.0% 76.87sec 1333064 298.78sec
Combo 2 Combo 2 unseen_blade 441144 25234397 84459 11.69 365217 735296 58.2 58.2 18.5% 0.0% 0.0% 0.0% 5.12sec 32968234 298.78sec
Combo 2 Combo 2 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.66sec 0 298.78sec
Combo 2 Combo 2 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 65.08sec 0 298.78sec
Combo 3 Combo 3 augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 3 Combo 3 auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.49sec 0 298.78sec
Combo 3 Combo 3 auto_attack_mh 0 14033708 46971 71.42 38388 77541 355.6 355.6 18.8% 16.4% 0.0% 0.0% 0.98sec 18310066 298.78sec
Combo 3 Combo 3 auto_attack_oh 1 6993628 23408 71.39 19131 38615 355.5 355.5 18.9% 16.4% 0.0% 0.0% 0.98sec 9124595 298.78sec
Combo 3 Combo 3 backstab 53 8966070 30009 14.99 72678 188870 74.7 74.7 40.8% 0.0% 0.0% 0.0% 3.69sec 11731844 298.78sec
Combo 3 Combo 3 cold_blood 382245 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 90.92sec 0 298.78sec
Combo 3 Combo 3 coup_de_grace 441776 26513027 88739 7.97 516983 1037766 13.3 39.7 29.0% 0.0% 0.0% 0.0% 22.30sec 34518839 298.78sec
Combo 3 Combo 3 eviscerate_coup_de_grace_bonus 462244 11289824 37787 7.66 229815 459754 0.0 38.2 28.7% 0.0% 0.0% 0.0% 0.00sec 11289824 298.78sec
Combo 3 Combo 3 cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.05sec 0 298.78sec
Combo 3 Combo 3 elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 3 Combo 3 elemental_focusing_lens_onyx 461191 5966063 19968 4.46 268769 0 22.2 22.2 0.0% 0.0% 0.0% 0.0% 12.91sec 5966063 298.78sec
Combo 3 Combo 3 eviscerate 196819 75539022 252828 13.73 848713 1746423 68.4 68.4 28.6% 0.0% 0.0% 0.0% 4.37sec 98262493 298.78sec
Combo 3 Combo 3 eviscerate_bonus 328082 32464910 108660 13.47 374158 761117 67.1 67.1 28.5% 0.0% 0.0% 0.0% 4.45sec 32464910 298.78sec
Combo 3 Combo 3 flagellation 384631 302306 1012 0.74 69470 138805 3.7 3.7 18.1% 0.0% 0.0% 0.0% 91.43sec 302306 298.78sec
Combo 3 Combo 3 flagellation_damage 394757 6021096 20153 4.84 209450 418845 0.0 24.1 19.4% 0.0% 0.0% 0.0% 0.00sec 6021096 298.78sec
Combo 3 Combo 3 flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 3 Combo 3 food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 3 Combo 3 instant_poison 315585 3642583 12192 56.97 10779 21701 0.0 283.7 18.9% 0.0% 0.0% 0.0% 0.00sec 3642583 298.78sec
Combo 3 Combo 3 legendary_skippers_citrine 462962 0 0 0.00 0 0 25.5 0.0 0.0% 0.0% 0.0% 0.0% 11.08sec 0 298.78sec
Combo 3 Combo 3 mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 68.25sec 0 298.78sec
Combo 3 Combo 3 old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 74.50sec 0 298.78sec
Combo 3 Combo 3 phantom_reaping 448669 6102079 20424 3.84 267872 536807 19.1 19.1 19.0% 0.0% 0.0% 0.0% 14.97sec 6102079 298.78sec
Combo 3 Combo 3 phantom_reaping_echo 448669 1007622 3372 2.57 66092 132383 12.8 12.8 19.1% 0.0% 0.0% 0.0% 6.25sec 1007622 298.78sec
Combo 3 Combo 3 potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.54sec 0 298.78sec
Combo 3 Combo 3 recuperator 426605 0 0 0.00 0 0 98.4 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 298.78sec
Combo 3 Combo 3 roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.2 0.0 0.0% 0.0% 0.0% 0.0% 79.09sec 0 298.78sec
Combo 3 Combo 3 rupture ticks -1943 29556323 98521 33.44 135982 282975 9.5 167.2 27.8% 0.0% 0.0% 0.0% 31.43sec 29556323 298.78sec
Combo 3 Combo 3 rupture_replicating_shadows ticks -394031 5430783 18103 0.00 25001 51917 167.2 0.0 27.8% 0.0% 0.0% 0.0% 1.76sec 5430783 298.78sec
Combo 3 Combo 3 secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.88sec 0 298.78sec
Combo 3 Combo 3 secret_technique_player 280720 20688530 69244 3.21 678541 2130459 0.0 16.0 42.5% 0.0% 0.0% 0.0% 0.00sec 26967583 298.78sec
Combo 3 Combo 3 secret_technique_clones 282449 60148806 201317 6.40 984759 3042856 0.0 31.9 43.9% 0.0% 0.0% 0.0% 0.00sec 60148806 298.78sec
Combo 3 Combo 3 shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.91sec 0 298.78sec
Combo 3 Combo 3 shadow_blades_attack ticks -279043 31441777 104806 0.00 79976 0 393.1 0.0 0.0% 0.0% 0.0% 0.0% 1.16sec 31441777 298.78sec
Combo 3 Combo 3 shadow_dance 185313 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.18sec 0 298.78sec
Combo 3 Combo 3 shadowstrike 185438 34797271 116466 10.45 279558 912712 52.0 52.0 61.5% 0.0% 0.0% 0.0% 5.80sec 45373734 298.78sec
Combo 3 Combo 3 squall_sailors_citrine 462952 1111852 3721 0.47 398085 797906 2.4 2.4 18.5% 0.0% 0.0% 0.0% 75.12sec 1111852 298.78sec
Combo 3 Combo 3 stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Combo 3 Combo 3 storm_sewers_citrine 462958 0 0 0.47 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 66.56sec 1578819 298.78sec
Combo 3 Combo 3 storm_sewers_citrine_damage 468422 251636 842 0.47 90659 182602 2.3 2.3 19.5% 0.0% 0.0% 0.0% 66.56sec 251636 298.78sec
Combo 3 Combo 3 suffocating_darkness ticks -449217 14133760 47113 21.42 132002 0 19.1 107.1 0.0% 0.0% 0.0% 0.0% 14.65sec 14133760 298.78sec
Combo 3 Combo 3 symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.28sec 0 298.78sec
Combo 3 Combo 3 thunderlords_crackling_citrine 462951 20559304 68812 7.01 494940 993792 34.9 34.9 18.9% 0.0% 0.0% 0.0% 8.49sec 20559304 298.78sec
Combo 3 Combo 3 undersea_overseers_citrine 462953 1288354 4312 0.46 478207 959094 2.3 2.3 18.6% 0.0% 0.0% 0.0% 65.68sec 1288354 298.78sec
Combo 3 Combo 3 unseen_blade 441144 25348377 84841 11.64 367664 741265 58.0 58.0 18.7% 0.0% 0.0% 0.0% 5.13sec 33113715 298.78sec
Combo 3 Combo 3 vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.49sec 0 298.78sec
Combo 3 Combo 3 windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 66.02sec 0 298.78sec
Equipped Equipped augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Equipped Equipped auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 122.31sec 0 298.78sec
Equipped Equipped auto_attack_mh 0 13988138 46818 70.84 38399 77448 352.7 352.7 19.5% 16.5% 0.0% 0.0% 0.98sec 18249550 298.78sec
Equipped Equipped auto_attack_oh 1 6972428 23337 70.80 19129 38642 352.6 352.6 19.4% 16.4% 0.0% 0.0% 0.98sec 9096275 298.78sec
Equipped Equipped backstab 53 9031196 30227 15.06 72988 188581 75.0 75.0 41.0% 0.0% 0.0% 0.0% 3.69sec 11815288 298.78sec
Equipped Equipped cold_blood 382245 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 90.60sec 0 298.78sec
Equipped Equipped coup_de_grace 441776 26735540 89483 7.96 518589 1045751 13.2 39.6 29.5% 0.0% 0.0% 0.0% 22.51sec 34805747 298.78sec
Equipped Equipped eviscerate_coup_de_grace_bonus 462244 11429541 38255 7.67 229981 464220 0.0 38.2 29.5% 0.0% 0.0% 0.0% 0.00sec 11429541 298.78sec
Equipped Equipped cryptic_instructions 449946 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.13sec 0 298.78sec
Equipped Equipped elemental_focusing_lens 461180 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Equipped Equipped elemental_focusing_lens_onyx 461191 5984577 20030 4.46 269715 0 22.2 22.2 0.0% 0.0% 0.0% 0.0% 12.90sec 5984577 298.78sec
Equipped Equipped eviscerate 196819 76346371 255530 13.73 860050 1743781 68.4 68.4 29.1% 0.0% 0.0% 0.0% 4.35sec 99313016 298.78sec
Equipped Equipped eviscerate_bonus 328082 32882329 110057 13.47 377543 766647 67.1 67.1 29.0% 0.0% 0.0% 0.0% 4.42sec 32882329 298.78sec
Equipped Equipped flagellation 384631 305631 1023 0.74 69669 138946 3.7 3.7 18.9% 0.0% 0.0% 0.0% 91.34sec 305631 298.78sec
Equipped Equipped flagellation_damage 394757 5988820 20044 4.77 209356 419708 0.0 23.8 20.3% 0.0% 0.0% 0.0% 0.00sec 5988820 298.78sec
Equipped Equipped flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Equipped Equipped food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Equipped Equipped instant_poison 315585 3636991 12173 56.51 10803 21735 0.0 281.4 19.4% 0.0% 0.0% 0.0% 0.00sec 3636991 298.78sec
Equipped Equipped legendary_skippers_citrine 462962 0 0 0.00 0 0 25.5 0.0 0.0% 0.0% 0.0% 0.0% 11.29sec 0 298.78sec
Equipped Equipped mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 63.11sec 0 298.78sec
Equipped Equipped old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 68.39sec 0 298.78sec
Equipped Equipped potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.60sec 0 298.78sec
Equipped Equipped recuperator 426605 0 0 0.00 0 0 98.4 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 298.78sec
Equipped Equipped roaring_warqueens_citrine 462964 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 65.97sec 0 298.78sec
Equipped Equipped rupture ticks -1943 29521739 98406 33.31 135754 281501 9.5 166.5 28.5% 0.0% 0.0% 0.0% 31.34sec 29521739 298.78sec
Equipped Equipped rupture_replicating_shadows ticks -394031 5424451 18082 0.00 24997 51637 166.5 0.0 28.5% 0.0% 0.0% 0.0% 1.76sec 5424451 298.78sec
Equipped Equipped secret_technique 280719 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 18.90sec 0 298.78sec
Equipped Equipped secret_technique_player 280720 20815544 69669 3.21 687982 2101703 0.0 16.0 43.5% 0.0% 0.0% 0.0% 0.00sec 27132586 298.78sec
Equipped Equipped secret_technique_clones 282449 60329611 201922 6.39 996850 3023015 0.0 31.8 44.3% 0.0% 0.0% 0.0% 0.00sec 60329611 298.78sec
Equipped Equipped shadow_blades 121471 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 90.85sec 0 298.78sec
Equipped Equipped shadow_blades_attack ticks -279043 31144931 103816 0.00 81275 0 383.1 0.0 0.0% 0.0% 0.0% 0.0% 1.19sec 31144931 298.78sec
Equipped Equipped shadow_dance 185313 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.11sec 0 298.78sec
Equipped Equipped shadowstrike 185438 35105083 117496 10.49 280873 915409 52.2 52.2 61.7% 0.0% 0.0% 0.0% 5.77sec 45774373 298.78sec
Equipped Equipped squall_sailors_citrine 462952 1125805 3768 0.47 400339 806689 2.3 2.3 20.0% 0.0% 0.0% 0.0% 67.35sec 1125805 298.78sec
Equipped Equipped stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.78sec
Equipped Equipped storm_sewers_citrine 462958 0 0 0.46 0 0 2.3 2.3 0.0% 0.0% 0.0% 0.0% 78.92sec 1556130 298.78sec
Equipped Equipped storm_sewers_citrine_damage 468422 246667 826 0.46 91615 183670 2.3 2.3 18.7% 0.0% 0.0% 0.0% 78.92sec 246667 298.78sec
Equipped Equipped suffocating_darkness ticks -449217 14243930 47480 21.48 132671 0 19.2 107.4 0.0% 0.0% 0.0% 0.0% 15.47sec 14243930 298.78sec
Equipped Equipped symbols_of_death 212283 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.27sec 0 298.78sec
Equipped Equipped thunderlords_crackling_citrine 462951 20525635 68699 6.92 498556 998748 34.4 34.4 19.5% 0.0% 0.0% 0.0% 8.48sec 20525635 298.78sec
Equipped Equipped undersea_overseers_citrine 462953 1334434 4466 0.47 480656 963336 2.3 2.3 19.7% 0.0% 0.0% 0.0% 66.26sec 1334434 298.78sec
Equipped Equipped unseen_blade 441144 25526710 85438 11.64 367791 740396 58.0 58.0 19.5% 0.0% 0.0% 0.0% 5.19sec 33344601 298.78sec
Equipped Equipped vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.31sec 0 298.78sec
Equipped Equipped windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 68.63sec 0 298.78sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health5,586,180.20.00.00%0.0100.0%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Fazed8.749.235.5s5.2s30.6s89.42%89.47%49.2 (49.2)7.8

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 159.1s
  • trigger_min/max:1.0s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 158.4s
  • uptime_min/max:80.02% / 98.12%

Stack Uptimes

  • fazed_1:89.42%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.749.235.6s5.2s30.5s89.43%89.49%49.2 (49.2)7.8

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 150.0s
  • trigger_min/max:1.0s / 25.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.6s
  • uptime_min/max:77.54% / 97.56%

Stack Uptimes

  • fazed_1:89.43%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.749.535.7s5.1s30.8s89.64%89.65%49.5 (49.5)7.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 154.2s
  • trigger_min/max:1.0s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 150.1s
  • uptime_min/max:80.72% / 98.62%

Stack Uptimes

  • fazed_1:89.64%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fazed8.849.235.4s5.2s30.3s89.27%89.43%49.2 (49.2)7.9

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_fazed
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.05
  • periodic:1.05
  • auto_attack:1.05
  • crit_chance:1.10
  • is_stacking:false

Trigger Details

  • interval_min/max:0.0s / 145.1s
  • trigger_min/max:1.0s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 143.3s
  • uptime_min/max:80.22% / 97.22%

Stack Uptimes

  • fazed_1:89.27%

Spelldata

  • id:441224
  • name:Fazed
  • tooltip:Taking {$=}w1% more damage from {$@=}auracaster.
  • description:{$@spelldesc441146={$?a137036=false}[Sinister Strike]?s200758[Gloomblade][Backstab] and {$?a137036=false}[Ambush][Shadowstrike] now also strike with an Unseen Blade dealing {$441144s1=0} damage. Targets struck are Fazed for {$441224d=10 seconds}. Fazed enemies take {$441224s1=5}% more damage from you and cannot parry your attacks. This effect may occur once every {$459485d=20 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.678.466.3s3.6s61.0s94.74%94.76%78.4 (78.4)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 279.0s
  • trigger_min/max:1.0s / 47.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 355.6s
  • uptime_min/max:76.21% / 100.00%

Stack Uptimes

  • find_weakness_1:94.74%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.678.566.3s3.6s61.5s94.81%94.82%78.5 (78.5)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 335.3s
  • trigger_min/max:1.0s / 45.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 332.2s
  • uptime_min/max:82.59% / 100.00%

Stack Uptimes

  • find_weakness_1:94.81%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.778.365.3s3.6s60.4s94.60%94.58%78.3 (78.3)3.7

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 338.1s
  • trigger_min/max:1.0s / 48.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.5s
  • uptime_min/max:81.89% / 100.00%

Stack Uptimes

  • find_weakness_1:94.60%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Find Weakness4.777.865.9s3.6s60.6s94.57%94.62%77.8 (77.8)3.7

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 306.0s
  • trigger_min/max:1.0s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.0s
  • uptime_min/max:80.67% / 100.00%

Stack Uptimes

  • find_weakness_1:94.57%

Spelldata

  • id:316220
  • name:Find Weakness
  • tooltip:{$=}w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Stealth abilities reveal a flaw in your target's defenses, causing all your attacks to bypass {$s1=30}% of that enemy's armor for {$316220d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flagellation3.70.090.9s91.3s11.8s14.63%22.22%0.0 (0.0)3.6

Buff Details

  • buff initial source:Equipped
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.1s
  • trigger_min/max:90.0s / 98.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.93% / 16.88%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.090.9s91.3s11.8s14.63%22.20%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 1
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 97.7s
  • trigger_min/max:90.0s / 97.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.87% / 16.89%

Stack Uptimes

  • flagellation_1:14.63%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.090.9s91.3s11.8s14.61%22.14%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 2
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.5s
  • trigger_min/max:90.0s / 98.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.86% / 16.89%

Stack Uptimes

  • flagellation_1:14.61%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Flagellation3.70.091.0s91.3s11.8s14.60%22.51%0.0 (0.0)3.6

Buff Details

  • buff initial source:Combo 3
  • cooldown name:buff_flagellation
  • max_stacks:30
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 98.0s
  • trigger_min/max:90.0s / 98.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s
  • uptime_min/max:12.90% / 16.92%

Stack Uptimes

  • flagellation_1:14.60%

Spelldata

  • id:384631
  • name:Flagellation
  • tooltip:{$?=}{$=}W2>0[{$@=}auracaster is tormenting the target, dealing {$394757s1=0} Shadow damage for each combo point spent.][Combo points spent deal {$394757s1=0} Shadow damage to {$@=}auracaster's tormented target. Mastery increased by {$=}{{$=}W3*$mas}.1%.]
  • description:Lash the target for {$s1=0} Shadow damage, causing each combo point spent within {$d=12 seconds} to lash for an additional {$394757s1=0}. Dealing damage with Flagellation increases your Mastery by {$=}{{$s2=1}*$mas}.1%, persisting {$394758d=12 seconds} after their torment fades.
  • max_stacks:30
  • duration:12.00
  • cooldown:90.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1114
Mean 298.78
Minimum 240.15
Maximum 359.95
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Fluffy_Pillow Damage Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1114
Mean 5893557.58
Minimum 5463772.90
Maximum 6345529.67
Spread ( max - min ) 881756.76
Range [ ( max - min ) / 2 * 100% ] 7.48%
Standard Deviation 140716.1069
5th Percentile 5664609.88
95th Percentile 6116378.92
( 95th Percentile - 5th Percentile ) 451769.04
Mean Distribution
Standard Deviation 4216.0060
95.00% Confidence Interval ( 5885294.36 - 5901820.80 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2190
0.1 Scale Factor Error with Delta=300 169032920
0.05 Scale Factor Error with Delta=300 676131677
0.01 Scale Factor Error with Delta=300 16903291907
HPS
Fluffy_Pillow Healing Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1114
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health020999370110
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.